Ugrás a tartalomra
Merck
Összes fotó(2)

Fontos dokumentumok

SAB2100822

Sigma-Aldrich

Anti-FLI1 antibody produced in rabbit

affinity isolated antibody

Szinonimák:

Anti-EWSR2, Anti-Friend leukemia virus integration 1, Anti-SIC-1

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(2)

About This Item

MDL-szám:
MFCD01864665
UNSPSC kód:
12352203
NACRES:
NA.41

biológiai forrás

rabbit

Minőségi szint

100

konjugátum

unconjugated

antitest forma

affinity isolated antibody

antitest terméktípus

primary antibodies

klón

polyclonal

form

buffered aqueous solution

molekulatömeg

51 kDa

faj reaktivitás

dog, human, rabbit, guinea pig, bovine

koncentráció

0.5 mg - 1 mg/mL

technika/technikák

immunohistochemistry: suitable
western blot: suitable

UniProt elérési szám

Q01543

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... FLI1(2313)

Related Categories

Általános leírás

Fli-1 proto-oncogene, ETS transcription factor (FLI1) is encoded by the gene mapped to human chromosome 11. The encoded protein belongs to the ETS family of transcription factors. FLI1 consists of ETS DNA-binding domain at its C-terminal end and is mainly expressed in hematopoietic and vascular endothelial cells.

Immunogen

Synthetic peptide directed towards the middle region of human FLI1

Alkalmazás

Anti-FLI1 antibody produced in rabbit has been used in chromatin immunoprecipitation.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Chromatin immunoprecipitation (1 paper)
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Chromatin immunoprecipitation (1 paper)

Biokémiai/fiziológiai hatások

Fli-1 proto-oncogene, ETS transcription factor (FLI1) acts as a sequence-specific transcriptional activator. It might be implicated in the development of both the haematopoietic and vascular systems. In addition, it also plays a vital role in megakaryopoiesis and platelet function. FLI1 functions as a regulator of essential midkine (MK) genes. Mutations in FLI1 is associated with the pathogenesis of Paris-Trousseau syndrome and congenital thrombocytopenia.

Szekvencia

Synthetic peptide located within the following region: FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMP

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

10 - Combustible liquids

WGK

WGK 3

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable

Analitikai tanúsítványok (COA)

Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

The ETS-domain transcription factor family.
Sharrocks AD
Nature Reviews in Molecular and Cell Biology, 2(11), 827-837 (2001)
Macrothrombocytopenia and dense granule deficiency associated with FLI1 variants: ultrastructural and pathogenic features.
Saultier P
Haematologica, 102(6), 1006-1016 (2017)
Gianfranco Matrone et al.
Proceedings of the National Academy of Sciences of the United States of America, 118(31) (2021-08-01)
A network of molecular factors drives the development, differentiation, and maintenance of endothelial cells. Friend leukemia integration 1 transcription factor (FLI1) is a bona fide marker of endothelial cells during early development. In zebrafish Tg( f li1:EGFP) y1 , we
Genotoxic stress inhibits Ewing sarcoma cell growth by modulating alternative pre-mRNA processing of the RNA helicase DHX9.
Fidaleo M
Oncotarget, 6(31), 31740-31757 (2015)
EWS, but not EWS-FLI-1, is associated with both TFIID and RNA polymerase II: interactions between two members of the TET family, EWS and hTAFII68, and subunits of TFIID and RNA polymerase II complexes.
Bertolotti A
Molecular and Cellular Biology, 18(3), 1489-1497 (1998)
View All Related Papers

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással