SAB1408106

Anti-MKI67IP antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Szinonimák: NIFK, Nopp34
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: IF; WB
• klón: polyclonal
• faj reaktivitás: human
• technika/technikák: indirect immunofluorescence: suitable; western blot: 1 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• molekulatömeg: antigen ~34.3 kDa
• faj reaktivitás: human
• technika/technikák: indirect immunofluorescence: suitable; western blot: 1 μg/mL
• NCBI elérési szám: NM_032390.3
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... MKI67IP(84365)

Leírás

Általános leírás

This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.(provided by RefSeq)

Immunogén

MKI67IP (NP_115766.2, 1 a.a. ~ 293 a.a) full-length human protein.

Sequence
MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable