SAB1406373

Anti-RARRES2 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Szinonimák: CHEMERIN, HP10433, TIG2
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: WB
• klón: polyclonal
• faj reaktivitás: human
• citations: 1
• technika/technikák: western blot: 1 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• molekulatömeg: antigen ~18.6 kDa
• faj reaktivitás: human
• technika/technikák: western blot: 1 μg/mL
• NCBI elérési szám: NM_002889.2
• UniProt elérési szám: Q99969
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... RARRES2(5919)

Leírás

Általános leírás

This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein. (provided by RefSeq)

Immunogén

RARRES2 (NP_002880.1, 1 a.a. ~ 163 a.a) full-length human protein.

Sequence
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS

Biokémiai/fiziológiai hatások

Chemerin activates chemerin-like receptor 1 (CMKLR1) and stimulates chemotaxis in macrophages, natural killer cells and immature dendritic cells. It is also involved in the activation of extracellular signal-regulated kinases, stimulation of blood vessel formation, migration and invasion.

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable