SAB1402791

Monoclonal Anti-GM2A, (C-terminal) antibody produced in mouse

clone 2C8, purified immunoglobulin, buffered aqueous solution

• Szinonimák: SAP-3
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 2C8, monoclonal
• form: buffered aqueous solution
• molekulatömeg: antigen ~37.11 kDa
• faj reaktivitás: human
• technika/technikák: capture ELISA: suitable; indirect ELISA: suitable
• izotípus: IgG2bκ
• NCBI elérési szám: NM_000405
• UniProt elérési szám: P17900
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... GM2A(2760)

Leírás

Általános leírás

This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. (provided by RefSeq)

Immunogen

GM2A (NP_000396.2, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
WIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable