Ugrás a tartalomra
Merck
Összes fotó(7)

Fontos dokumentumok

HPA003259

Sigma-Aldrich

Anti-MITF antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Szinonimák:

MI, Microphthalmia-associated transcription factor, WS2, WS2A, bHLHe32

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez


About This Item

MDL-szám:
UNSPSC kód:
12352203
Human Protein Atlas-szám:
NACRES:
NA.41
konjugátum:
unconjugated
application:
IHC
klón:
polyclonal
faj reaktivitás:
human
citations:
34
technika/technikák:
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

biológiai forrás

rabbit

Minőségi szint

konjugátum

unconjugated

antitest forma

affinity isolated antibody

antitest terméktípus

primary antibodies

klón

polyclonal

termékcsalád

Prestige Antibodies® Powered by Atlas Antibodies

Forma

buffered aqueous glycerol solution

faj reaktivitás

human

fejlettebb validálás

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technika/technikák

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

immunogén szekvencia

HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT

UniProt elérési szám

alkalmazás(ok)

research pathology

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... MITF(4286)

Általános leírás

MITF (microphthalmia-associated transcription factor) is a basic helix-loop-helix, leucine-zipper transcription factor. It is located on human chromosome 3p13.
Microphthalmia-associated transcription factor (MITF) is a bHLH-ZIP transcription factor that recognizes E-box (CAYRTG) and M-box (TCAYRTG or CAYRTGA) sequences in the promoter regions of target genes. Microphthalmia-associated transcription factor (MITF) is a master regulator in melanocyte proliferation, development, survival and melanoma formation and an essential regulator of osteoclastogenesis.
Rabbit polyclonal anti-MITF antibody recognizes human microphthalmia-associated transcription factor.

Immunogén

Microphthalmia-associated transcription factor recombinant protein epitope signature tag (PrEST)

Alkalmazás

Anti-MITF antibody has been used in immunohistochemistry and chromatin immunoprecipitation.
Rabbit polyclonal anti-MITF antibody is used to tag microphthalmia-associated transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of microphthalmia-associated transcription factor in melanocyte proliferation, development, and survival and the regulation of regulator of osteoclastogenesis.

Biokémiai/fiziológiai hatások

MITF (microphthalmia-associated transcription factor) participates in the growth and differentiation of melanocytes. Mutations in MITF results in waardenburg syndrome type IIa.

Tulajdonságok és előnyök

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST84788

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

10 - Combustible liquids

WGK

WGK 1

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable

Egyéni védőeszköz

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Válasszon a legfrissebb verziók közül:

Analitikai tanúsítványok (COA)

Lot/Batch Number

Nem találja a megfelelő verziót?

Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

The MITF, p. E318K Variant, as a Risk Factor for Pheochromocytoma and Paraganglioma.
Castro-Vega L J, et al.
The Journal of clinical endocrinology and metabolism, 101(12), 4764-4768 (2016)
Human melanocytes mitigate keratinocyte-dependent contraction in an in vitro collagen contraction assay
Rakar J, et al.
Burns : Journal of the International Society For Burn Injuries, 41(5), 1035-1042 (2015)
Stefanie Riesenberg et al.
Nature communications, 6, 8755-8755 (2015-11-05)
Inflammation promotes phenotypic plasticity in melanoma, a source of non-genetic heterogeneity, but the molecular framework is poorly understood. Here we use functional genomic approaches and identify a reciprocal antagonism between the melanocyte lineage transcription factor MITF and c-Jun, which interconnects
Melanocyte development in the mouse tail epidermis requires the Adamts9 metalloproteinase
Tharmarajah G, et al.
Pigment Cell & Melanoma Research (2018)
Jörg Steinfeld et al.
Development (Cambridge, England), 140(24), 4959-4969 (2013-11-15)
The retinal pigment epithelium (RPE) is indispensable for vertebrate eye development and vision. In the classical model of optic vesicle patterning, the surface ectoderm produces fibroblast growth factors (FGFs) that specify the neural retina (NR) distally, whereas TGFβ family members

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással