HPA001761
Anti-SEMA3G antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Szinonimák:
Anti-Sem2 antibody produced in rabbit, Anti-Semaphorin-3G precursor antibody produced in rabbit
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(5)
About This Item
konjugátum:
unconjugated
application:
IHC
klón:
polyclonal
faj reaktivitás:
human
citations:
6
technika/technikák:
immunohistochemistry: 1:50-1:200
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
termékcsalád
Prestige Antibodies® Powered by Atlas Antibodies
Forma
buffered aqueous glycerol solution
faj reaktivitás
human
technika/technikák
immunohistochemistry: 1:50-1:200
immunogén szekvencia
VRWLLQRPGDEGPDQVKTDERVLHTERGLLFRRLSRFDAGTYTCTTLEHGFSQTVVRLALVVIVASQLDNLFPPEPKPEEPPARGGLASTPPKAWYKDILQLIG
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... SEMA3G(56920)
Immunogén
Semaphorin-3G precursor recombinant protein epitope signature tag (PrEST)
Alkalmazás
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
Biokémiai/fiziológiai hatások
SEMA3G (semaphorin 3G) belongs to the large, evolutionarily conserved family of signaling molecules. Class 3 semaphorins is sub classified into six types named as sema3A to sema3F. SEMA3G acts as a novel peroxisome proliferator-activated receptor γ (PPAR-γ) regulated gene, which is centrally associated with the endothelial cell migration. It is a downstream effector of PPAR-γ. SEMA3G possesses anti-migration and anti-invasion ability.
Tulajdonságok és előnyök
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Kapcsolódás
Corresponding Antigen APREST85018
Fizikai forma
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Jogi információk
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 1
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Egyéni védőeszköz
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Válasszon a legfrissebb verziók közül:
Analitikai tanúsítványok (COA)
Lot/Batch Number
Nem találja a megfelelő verziót?
Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Dominique Leitner et al.
Acta neuropathologica, 148(1), 9-9 (2024-07-23)
Cerebral amyloid angiopathy (CAA) is characterized by amyloid beta (Aβ) deposition in cerebrovasculature. It is prevalent with aging and Alzheimer's disease (AD), associated with intracerebral hemorrhage, and contributes to cognitive deficits. To better understand molecular mechanisms, CAA(+) and CAA(-) vessels
Weiwei Liu et al.
Journal of cellular biochemistry, 116(4), 514-523 (2014-10-23)
In addition to regulating lipid and glucose metabolism, the nuclear receptor PPAR-γ has emerged as a potentially relevant player in regulating endothelial cell function. Despite the identification of numerous PPAR-γ targets involved in vascular development, the targets downstream of PPAR-γ
Xiuping Zhou et al.
Oncology reports, 28(1), 269-275 (2012-05-09)
Glioblastoma multiforme is the most aggressive type of brain tumor with a strong ability to invade and migrate into surrounding normal brain tissues, leading to high tumor recurrence and mortality. Most of class-3 semaphorins, especially SEMA3A, SEMA3B and SEMA3F, have
Ryoichi Ishibashi et al.
Scientific reports, 6, 25955-25955 (2016-05-18)
Kidney diseases including diabetic nephropathy have become huge medical problems, although its precise mechanisms are still far from understood. In order to increase our knowledge about the patho-physiology of kidney, we have previously identified >300 kidney glomerulus-enriched transcripts through large-scale
Craig B Stevens et al.
Gene expression patterns : GEP, 5(5), 647-653 (2005-06-09)
The semaphorins are a large, evolutionarily conserved family of signaling molecules with broad functions during development. The class 3 semaphorins are a subclass of secreted semaphorins found in vertebrates. There have been six class 3 semaphorins identified to date (sema3A
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással