Ugrás a tartalomra
Merck
Összes fotó(3)

Fontos dokumentumok

AV48174

Sigma-Aldrich

Anti-IGFBP7 antibody produced in rabbit

affinity isolated antibody

Szinonimák:

Anti-FSTL2, Anti-IGFBP-7, Anti-IGFBP-7v, Anti-Insulin-like growth factor binding protein 7, Anti-MAC25, Anti-PSF

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez


About This Item

UNSPSC kód:
12352203
NACRES:
NA.41

biológiai forrás

rabbit

Minőségi szint

konjugátum

unconjugated

antitest forma

affinity isolated antibody

antitest terméktípus

primary antibodies

klón

polyclonal

form

buffered aqueous solution

molekulatömeg

29 kDa

faj reaktivitás

horse, human, rat, guinea pig, dog, bovine, rabbit

koncentráció

0.5 mg - 1 mg/mL

technika/technikák

immunohistochemistry: suitable
western blot: suitable

NCBI elérési szám

UniProt elérési szám

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... IGFBP7(3490)

Általános leírás

Insulin-like growth factor binding protein 7 (IGFBP7) is a protein that strongly binds to IGF-I and with low affinity to IGF-II. It is known to mediate cell adhesion and the production of prostacyclin. Loss of IGFBP7 expression has been associated with tumorigenesis.
Rabbit Anti-IGFBP7 antibody recognizes human, canine, bovine, pig, mouse, and rat IGFBP7.

Immunogen

Synthetic peptide directed towards the C terminal region of human IGFBP7

Alkalmazás

Rabbit Anti-IGFBP7 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biokémiai/fiziológiai hatások

IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.

Szekvencia

Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

10 - Combustible liquids

WGK

WGK 3

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable


Analitikai tanúsítványok (COA)

Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

Narendra Wajapeyee et al.
Cell, 132(3), 363-374 (2008-02-13)
Expression of an oncogene in a primary cell can, paradoxically, block proliferation by inducing senescence or apoptosis through pathways that remain to be elucidated. Here we perform genome-wide RNA-interference screening to identify 17 genes required for an activated BRAF oncogene
Valentina Evdokimova et al.
Science signaling, 5(255), ra92-ra92 (2012-12-20)
Insulin-like growth factor-binding protein 7 (IGFBP7) is a secreted factor that suppresses growth, and the abundance of IGFBP7 inversely correlates with tumor progression. Here, we showed that pretreatment of normal and breast cancer cells with IGFBP7 interfered with the activation
J Darr et al.
Oncogene, 33(23), 3024-3032 (2013-07-16)
SMARCB1 (Snf5/Ini1/Baf47) is a potent tumor suppressor, the loss of which serves as the diagnostic feature in malignant rhabdoid tumors (MRT) and atypical teratoid/rhabdoid tumors (AT/RT), two highly aggressive forms of pediatric neoplasms. SMARCB1 is a core subunit of Swi/Snf

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással