AV43905
Anti-SLC20A1 antibody produced in rabbit
affinity isolated antibody
Szinonimák:
Anti-DKFZp686J2397, Anti-FLJ41426, Anti-GLVR1, Anti-Glvr-1, Anti-PIT1, Anti-PiT-1, Anti-Solute carrier family 20 (phosphate transporter), member 1
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(1)
About This Item
UNSPSC kód:
12352203
NACRES:
NA.41
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
form
buffered aqueous solution
molekulatömeg
74 kDa
faj reaktivitás
pig, dog, horse, bovine, human
koncentráció
0.5 mg - 1 mg/mL
technika/technikák
western blot: suitable
NCBI elérési szám
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... SLC20A1(6574)
Related Categories
Általános leírás
Sodium-dependent phosphate transporter 1 (SLC20A1) protein is an inorganic phosphate transporter and a sodium-phosphate symporter. It is expressed in the plasma membrane and belongs to the inorganic phosphate transporter family (PiT). Also called PIT1, it is an N-linked glycosylated protein with N and C termini placed in the extracellular region. It comprises 12 transmembrane domains. SLC20A1 gene is mapped to human chromosome 2q14.1.
Egyediség
Anti-SLC20A1 polyclonal antibody reacts with canine and human solute carrier family 20 (phosphate transporter) member 1 proteins.
Immunogen
Synthetic peptide directed towards the C terminal region of human SLC20A1
Alkalmazás
Anti-SLC20A1 antibody produced in rabbit has been used in western blotting (1:1000).
Biokémiai/fiziológiai hatások
Sodium-dependent phosphate transporter 1 (SLC20A1) protein is a high-affinity sodium (Na+)-phosphate (Pi) co-transporter that imports inorganic phosphate (Pi). It serves as a receptor for gibbon ape leukemia virus (GALV), feline leukemia virus type B (FeLV-B), woolly monkey virus and 10A1 murine leukemia virus, making it crucial for viral entry. SLC20A1 is essential for urinary tract and urorectal development. Variants ofSLC20A1 gene are implicated in the pathophysiology of bladder exstrophy-epispadias complex (BEEC) and in cloacal exstrophy. It may also participate in normal growth and development of the liver. Elevated expression of SLC20A1 gene is correlated to the activation of the wingless (Wnt)/β-catenin signaling pathway in somatotroph adenomas. SLC20A1 protein may participate in tumor necrosis factor-induced apoptosis and regulate cell proliferation, erythroid and B cell differentiation.
Szekvencia
Synthetic peptide located within the following region: LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL
Fizikai forma
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 3
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Analitikai tanúsítványok (COA)
Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Mengqi Chang et al.
Frontiers in endocrinology, 11, 596554-596554 (2021-02-13)
Pituitary adenomas (PAs) can be classified as non-secreting adenomas, somatotroph adenomas, corticotroph adenomas, lactotroph adenomas, and thyrotroph adenomas. Substantial advances have been made in our knowledge of the pathobiology of PAs. To obtain a comprehensive understanding of the molecular biological
Eugénie Koumakis et al.
Scientific reports, 9(1), 1808-1808 (2019-02-14)
PiT1/SLC20A1 is an inorganic phosphate transporter with additional functions including the regulation of TNFα-induced apoptosis, erythropoiesis, cell proliferation and insulin signaling. Recent data suggest a relationship between PiT1 and NF-κB-dependent inflammation: (i) Pit1 mRNA is up-regulated in the context of
Laurent Beck et al.
PloS one, 5(2), e9148-e9148 (2010-02-18)
PiT1 (or SLC20a1) encodes a widely expressed plasma membrane protein functioning as a high-affinity Na(+)-phosphate (Pi) cotransporter. As such, PiT1 is often considered as a ubiquitous supplier of Pi for cellular needs regardless of the lack of experimental data. Although
Karen B Farrell et al.
Journal of virology, 76(15), 7683-7693 (2002-07-05)
The mammalian gammaretroviruses gibbon ape leukemia virus (GALV) and feline leukemia virus subgroup B (FeLV-B) can use the same receptor, Pit1, to infect human cells. A highly polymorphic nine-residue sequence within Pit1, designated region A, has been proposed as the
Johanna Magdalena Rieke et al.
Frontiers in cell and developmental biology, 8, 567-567 (2020-08-28)
Previous studies in developing Xenopus and zebrafish reported that the phosphate transporter slc20a1a is expressed in pronephric kidneys. The recent identification of SLC20A1 as a monoallelic candidate gene for cloacal exstrophy further suggests its involvement in the urinary tract and
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással