APREST74709

PrEST Antigen SST

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Szinonimák: SMST
• UNSPSC kód: 12352202

Tulajdonságok

• rekombináns: expressed in E. coli
• Teszt: >80% (SDS-PAGE)
• Forma: buffered aqueous solution
• molekulatömeg: predicted mol wt 27 kDa
• tisztítva: immobilized metal affinity chromatography (IMAC)
• koncentráció: ≥0.5 mg/mL
• immunogén szekvencia: APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKN
• Ensembl | humán elérési szám: ENSG00000157005
• UniProt elérési szám: P61278
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• Géninformáció: human ... SST(6750)

Leírás

Általános leírás

Recombinant protein fragment of Human SST with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Alkalmazás

Suitable as a blocking agent using corresponding antibodies.

Kapcsolódás

Corresponding Antibody HPA019472.

Fizikai forma

Solution in 1 M urea-PBS, pH 7.4

Elkészítési megjegyzés

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Jogi információk

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 2
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable