SAB2101567

Anti-NET1 (ab1) antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-ARHGEF8, Anti-NET1A, Anti-Neuroepithelial cell transforming gene 1
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 62 kDa
• Speziesreaktivität: human, rat
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• UniProt-Hinterlegungsnummer: Q5SQI7
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... NET1(10276)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human NET1

Biochem./physiol. Wirkung

NET1 acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. It may be involved in activation of the SAPK/JNK pathway.

Sequenz

Synthetic peptide located within the following region: AILIIQGVLSDINLKKGESECQYYIDKLEYLDEKQRDPRIEASKVLLCHG

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable