Přejít k obsahu
Merck
Všechny fotografie(6)

Hlavní dokumenty

WH0008192M1

Sigma-Aldrich

Monoclonal Anti-CLPP antibody produced in mouse

clone 300, purified immunoglobulin, buffered aqueous solution

Synonyma:

Anti-ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)

Přihlásitk zobrazení cen stanovených pro organizaci a smluvních cen


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

300, monoclonal

form

buffered aqueous solution

species reactivity

rat, human, mouse

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CLPP(8192)

Související kategorie

General description

CLPP (caseinolytic mitochondrial matrix peptidase proteolytic subunit) protein contains an aqueous chamber formed by face-to-face assembly of the two heptameric rings that have proteolytic active sites within. It is a member of the peptidase family S14. The CLPP gene is localized to human chromosome 19p13.3.

Immunogen

CLPP (NP_006003, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

Application

Monoclonal Anti-CLPP antibody produced in mouse has been used in Western Blotting.

Biochem/physiol Actions

CLPP (caseinolytic mitochondrial matrix peptidase proteolytic subunit) gene encodes a protease component of the Clp complex that hydrolyzes peptides and various proteins in the presence of ATP. The protein requires magnesium for its activity. CLPP is found to be associated with the inner mitochondrial membrane.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ještě jste nenalezli správný produkt?  

Vyzkoušejte náš produkt Nástroj pro výběr produktů.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Osvědčení o analýze (COA)

Vyhledejte osvědčení Osvědčení o analýze (COA) zadáním čísla šarže/dávky těchto produktů. Čísla šarže a dávky lze nalézt na štítku produktu za slovy „Lot“ nebo „Batch“.

Již tento produkt vlastníte?

Dokumenty související s produkty, které jste v minulosti zakoupili, byly za účelem usnadnění shromážděny ve vaší Knihovně dokumentů.

Navštívit knihovnu dokumentů

Perrault syndrome is caused by recessive mutations in CLPP, encoding a mitochondrial ATP-dependent chambered protease
Emma M Jenkinson
American Journal of Human Genetics, 92 (2013)
Ablation of the mitochondrial complex IV assembly protein Surf1 leads to increased expression of the UPRMT and increased resistance to oxidative stress in primary cultures of fibroblasts
Gavin Pharaoh
Redox Biology (2016)
Crystallography and mutagenesis point to an essential role for the N-terminus of human mitochondrial ClpP
Sung Gyun Kang
Journal of Structural Biology, 148 (2004)
Gavin Pharaoh et al.
Redox biology, 8, 430-438 (2016-05-22)
Mice deficient in the electron transport chain (ETC) complex IV assembly protein SURF1 have reduced assembly and activity of cytochrome c oxidase that is associated with an upregulation of components of the mitochondrial unfolded protein response (UPR(MT)) and increased mitochondrial
Shylesh Bhaskaran et al.
EMBO reports, 19(3) (2018-02-09)
Caseinolytic peptidase P (ClpP) is a mammalian quality control protease that is proposed to play an important role in the initiation of the mitochondrial unfolded protein response (UPRmt), a retrograde signaling response that helps to maintain mitochondrial protein homeostasis. Mitochondrial

Náš tým vědeckých pracovníků má zkušenosti ve všech oblastech výzkumu, včetně přírodních věd, materiálových věd, chemické syntézy, chromatografie, analytiky a mnoha dalších..

Obraťte se na technický servis.