SAB2101340

Anti-LHX3 antibody produced in rabbit

affinity isolated antibody

• Synonyma: Anti-DKFZp762A2013, Anti-LIM homeobox 3, Anti-M2-LHX3
• MDL number: MFCD03096989
• UNSPSC Code: 12352203
• NACRES: NA.41

Vlastnosti

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 44 kDa
• species reactivity: bovine, goat, human, guinea pig, dog, horse, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: Q9UBR4
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... LHX3(8022)

Popis

General description

The previously assigned protein identifier Q5TB40 has been merged into Q9UBR4. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the middle region of human LHX3

Biochem/physiol Actions

LHX3 encodes a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. This gene encodes a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene.

Sequence

Synthetic peptide located within the following region: PSGAPGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Bezpečnostní informace

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable