Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

N17001

Sigma-Aldrich

Noggin human

recombinant, expressed in HEK 293 cells, suitable for cell culture

Sinónimos:

Noggin human

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Número MDL:
Código UNSPSC:
12352202
NACRES:
NA.77

recombinante

expressed in HEK 293 cells

Nivel de calidad

Ensayo

≥98% (SDS-PAGE)

Formulario

lyophilized powder

potencia

≤10 ng/mL ED50

mol peso

23 kDa (The protein migrates as a 25 kDa band on SDS-PAGE due to glycosylation)

técnicas

cell culture | mammalian: suitable

temp. de almacenamiento

−20°C

¿Está buscando productos similares? Visita Guía de comparación de productos

Descripción general

Recombinant human Noggin is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 23 kDa. This protein is manufactured in human cells using an all-human production system, with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture.

Acciones bioquímicas o fisiológicas

Noggin is a secreted protein that inhibits the binding of bone morphogenetic proteins (BMPs) to their cognate receptor. It is a 232 amino acid-secreted glycosylated protein, which forms covalently linked homodimers and has high affinity for BMP4. hESC cultured with noggin (in medium or incorporated into extracellular matrix) form denser colonies compared to normal hESC cultures, suggesting that the presence of noggin promotes better growth. Noggin can be incorporated as a medium supplement for maintaining stem cells in a pluripotent state, for short-term culture experiments. Noggin does not trigger differentiation towards a neuronal lineage. Furthermore, when incorporated into extracellular matrix, noggin prevented spontaneous differentiation during the time period examined. In a surgically induced knee osteoarthritis model in mice, expression of noggin mRNA was lost from the articular cartilage, which correlated with loss of BMP2/4 and pSMAD1/5/8, an indicator of active BMP signaling.

Secuencia

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Nota de análisis

The biological activity of recombinant human noggin was tested in culture by measuring its ability to inhibit BMP4-induced alkaline phosphatase production by ATDC5 cells (human erythroleukemic indicator cell line).
The EC50 is defined as the effective concentration of growth factor that elicits a 50% decrease in alkaline phosphatase secretion in a cell based bioassay.

Código de clase de almacenamiento

11 - Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

The expression patterns of gremlin 1 and noggin in normal adult and tumor tissues.
Laurilla R, et al.
International Journal of Clinical and Experimental Pathology, 6(7), 1400-1408 (2013)
Wenjing Xiao et al.
Autophagy, 18(11), 2615-2635 (2022-03-08)
Macroautophagy/autophagy is a conserved cellular process associated with tumorigenesis and aggressiveness, while mechanisms regulating expression of autophagic machinery genes in cancers still remain elusive. Herein, we identified E2F4 (E2F transcription factor 4) as a novel transcriptional activator of cytoprotective autophagy

Artículos

Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com

Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com

Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com

Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico