SAE0105
MT1 (Melatonin Receptor 1)
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Productos recomendados
recombinant
expressed in Sf9 cells
description
N-Terminal contains a strep tag II and 10X Histidine tag followed by a TEV protease cleavage site.
assay
≥90% (SDS-PAGE)
form
aqueous solution
mol wt
44.8 kDa
concentration
1 mg/mL
UniProt accession no.
shipped in
dry ice
storage temp.
−70°C
Biochem/physiol Actions
Melatonin receptor 1 (MT1) is a class A GPCR that modulates neuronal firing, arterial vasoconstriction, cell proliferation in cancer cells, and reproductive and metabolic functions.
Sequence
MASAWSHPQFEKGGGSGGGSGGSAWSHPQFEKGAHHHHHHHHHHENLYFQGQGNGSALPNASQPVLRGDGARPSWLASALACVLIFTIVVDILGNLLVILSVYRNKKLRNAGNIFVVSLAVADLVVAIYPYPLVLMSIFNNGWNLGYLHCQVSGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLYSSKNSLCYVLLIWLLTLAAVLPNLRAGTLQYDPRIYSCTFAQSVSSAYTIAVVVFHFLVPMIIVIFCYLRIWILVLQVRQRVKPDRKPKLKPQDFRNFVTMFVVFVLFAICWAPLNFIGLAVASDPASMVPRIPEWLFVASYYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV
Preparation Note
Formulated in 25mM Na2HPO4 pH 8.0, 150mM NaCl, 0.86%/0.18% Sarkosyl/CHS.
Storage and Stability
Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot into single use aliquots. Store remaining undiluted protein in aliquots at -80°C.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 29(9), 2885-2889 (2009-03-06)
Melatonin transmits photoperiodic signals that regulate reproduction. Two melatonin receptors (MT1 and MT2) have been cloned in mammals and additional melatonin binding sites suggested, but the receptor that mediates the effects of melatonin on the photoperiodic gonadal response has not
Nature, 569(7756), E6-E6 (2019-05-03)
Change history: In this Letter, the rotation signs around 90°, 135° and 15° were missing and in the HTML, Extended Data Tables 2 and 3 were the wrong tables; these errors have been corrected online.
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico