Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

M1882

Sigma-Aldrich

Myoglobin from equine heart

Myoglobin from equine heart
1 of 1 reviewers received a sample product or took part in a promotion

≥90% (SDS-PAGE), essentially salt-free, lyophilized powder

Sinonimo/i:

Myoglobin from horse heart

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

250 MG
CHF 113.00
1 G
CHF 430.00
5 G
CHF 1’470.00
10 G
CHF 2’470.00

CHF 113.00

Check Cart for Availability
Richiedi un ordine bulk
Tutte le immagini(3)

Scegli un formato

Cambia visualizzazione
250 MG
CHF 113.00
1 G
CHF 430.00
5 G
CHF 1’470.00
10 G
CHF 2’470.00

About This Item

Numero CAS:
100684-32-0
Numero CE:
309-705-0
Numero MDL:
MFCD00131643
Codice UNSPSC:
12352202
NACRES:
NA.61

CHF 113.00

Check Cart for Availability
Richiedi un ordine bulk

Origine biologica

equine heart

Saggio

≥90% (SDS-PAGE)

Stato

essentially salt-free, lyophilized powder

Tenore di ferro

≥0.20%

tecniche

MALDI-MS: suitable

N° accesso UniProt

P68082

Temperatura di conservazione

−20°C

Informazioni sul gene

horse ... MB(100054434)

Cerchi prodotti simili? Visita Guida al confronto tra prodotti

Applicazioni

Myoglobin from equine heart is suitable for use in:
  • spectral measurements in Beckman DU-50 or Gilford 2400 spectrophotometer[1]
  • the secondary structure analysis of proteins in H2O solution using single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy[2]
  • the calibration of the mass scale at a concentration of 2 pmol/μL in Electrospray mass spectrometry[3]
  • a study to investigate on-line single droplet deposition for MALDI mass spectrometry[4]
  • a study to examine protein adsorption in fused-silica and polyacrylamide-coated capillaries[5]

Azioni biochim/fisiol

Myoglobin is a mobile carrier of oxygen that is developed in red muscle and heart cells. This happens as a response to elevated demand for oxygen during exercise, and transports oxygen from the sarcolemma to the mitochondria of vertebrate heart and red muscle cells.[6]

Applicazioni

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

11 - Combustible Solids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, type N95 (US)

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
0000429360
0000429359
0000429359
0000429360
0000403217

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Guadalupe Gómez-Baena et al.
Scientific reports, 9(1), 10757-10757 (2019-07-26)
Major urinary proteins (MUP) are the major component of the urinary protein fraction in house mice (Mus spp.) and rats (Rattus spp.). The structure, polymorphism and functions of these lipocalins have been well described in the western European house mouse
D H Robertson et al.
Rapid communications in mass spectrometry : RCM, 11(7), 786-790 (1997-01-01)
Major urinary proteins (MUPs) from the urine of individual wild mice were characterized using electrospray ionization mass spectrometry (ESI-MS) and compared to MUPs from the urine of inbred mice. The wild mice showed considerable variation between individuals in the expression
Ursula Waack et al.
mBio, 9(6) (2018-12-20)
Antibiotic-resistant Acinetobacter baumannii is increasingly recognized as a cause of difficult-to-treat nosocomial infections, including pneumonia, wound infections, and bacteremia. Previous studies have demonstrated that the metalloprotease CpaA contributes to virulence and prolongs clotting time when added to human plasma as
Laurent Marichal et al.
Langmuir : the ACS journal of surfaces and colloids, 36(28), 8218-8230 (2020-06-26)
Protein adsorption on nanoparticles is an important field of study, particularly with regard to nanomedicine and nanotoxicology. Many factors can influence the composition and structure of the layer(s) of adsorbed proteins, the so-called protein corona. However, the role of protein
Computer-controlled perifusion system for neuroendocrine tissues: development and applications.
A Negro-Vilar et al.
Methods in enzymology, 124, 67-79 (1986-01-01)
Visualizza tutti i documenti correlati

Articoli

Simple Digestion Protocol for Proteomics Sample Prep

Rapid trypsin digest kit yields reliable results in less than 2 hours for mass spectrometry analysis.

Chromatograms

application for HPLC
1 Review This action will navigate to reviews.

Questions

1–7 of 7 Questions  

  1. Is equine myoglobin (M1882) detectable and quantifiable by common laboratory tests (ECL) for the detection of human myoglobin?

    1 answer

    1. This item has not been tested in-house for detectability and quantifiability by common laboratory tests. The specifications for this item do not include testing by these methods.

      Helpful?

  2. Do you have the sequence for Product M1882, Myoglobin from equine heart?

    1 answer

    1. Product M1882 - Myoglobin from equine heart is purified from equine heart.  It is not sequenced.Accession P68082 for equine myoglobin has the following sequenceMGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQGI hope that you find this information helpful.If you have further questions, please reply to this email.Sincerely,Audrey FlemingSigma-Aldrich Technical Service

      Helpful?

  3. What is the Department of Transportation shipping information for this product?

    1 answer

    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      Helpful?

  4. Is Product M1882, Myoglobin from equine heart, oxidized?

    1 answer

    1. Yes, it is oxidized.

      Helpful?

  5. Is Product M1882, Myoglobin from equine heart, metmyoglobin?

    1 answer

    1. The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.

      Helpful?

  6. Which has more affinity for oxygen, hemoglobin or myoglobin?

    1 answer

    1. The affinity of myoglobin for oxygen is higher than that of hemoglobin.

      Helpful?

  7. What is the molecular weight of Product M1882, Myoglobin from equine heart?

    1 answer

    1. Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.

      Helpful?

Reviews

1 of 1 reviewers received a sample product or took part in a promotion

Active Filters

  1. New York
    • Review 1
    • Votes 0
    4 out of 5 stars.

    Is the myoglobin from equine heart dispersive in water?
    Or what are the solvent where it is dispersive.

    Helpful?

    1. Response from MilliporeSigma:

      Thank you for your review. We encourage customers who experience problems with our products to call or email us for additional technical support. Please visit https://www.sigmaaldrich.com/US/en/support/customer-support to submit a Product Technical Inquiry.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.