HPA044620

Anti-GPD1 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Glycerol-3-phosphate dehydrogenase 1 (soluble)
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA044620

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIK
• UniProt-Hinterlegungsnummer: P21695
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... GPD1(2819)

Beschreibung

Allgemeine Beschreibung

Glycerol-3-phosphate dehydrogenase 1 (GPD1) is encoded by the gene mapped to human chromosome 12q13.12. The encoded protein is a member of NAD-dependent glycerol-3-phosphate dehydrogenase family. GPD1 is a cytoplasmic protein with NAD_Gly3P_dh_N and NAD_Gly3P_dh_C domains.

Immunogen

glycerol-3-phosphate dehydrogenase 1 (soluble) recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Glycerol-3-phosphate dehydrogenase 1(GPD1) has been used in western blot analysis.

Biochem./physiol. Wirkung

Glycerol-3-phosphate dehydrogenase 1 (GPD1) facilitates the reversible conversion of dihydroxyacetone phosphate (DHAP) and reduced nicotine adenine dinucleotide(NADH) to glycerol-3-phosphate (G3P) and nicotinamide adenine dinucleotide (NAD⁺). GPD1 along with a mitochondrial enzyme, glycerol-3 phosphate dehydrogenase 2 (GPD2), plays an essential role in carrying reducing equivalents from the cytosol to the mitochondria.1It also stimulates growth under osmotic stress. Loss of gene function inhibits glycerol production, retard growth at all under anoxic conditions and strong osmosensitivity. Mutation in the gene is associated with the development of transient infantile hypertriglyceridemia, fatty Liver and hepatic fibrosis.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST81141

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable