WH0026227M1

Monoclonal Anti-PHGDH antibody produced in mouse

clone 4A3-1D6, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-3PGDH, Anti-MGC3017, Anti-PDG, Anti-PGAD, Anti-PGD, Anti-PGDH, Anti-SERA, Anti-phosphoglycerate dehydrogenase
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4A3-1D6, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão GenBank: BC011262
• nº de adesão UniProt: O43175
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PHGDH(26227)

Descrição

Imunogênio

PHGDH (AAH11262.1, 1 a.a. ~ 533 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF

Aplicação

Monoclonal Anti-PHGDH antibody produced in mouse has been used in Western Blotting.

Ações bioquímicas/fisiológicas

The gene PHGDH (D-3-phosphoglycerate dehydrogenase) is mapped to human chromosome 1p. The enzyme is mainly responsible for catalyzing initial step of the serine synthesis pathway, converting 3-phosphoglycerate into 3-phosphohydroxypyruvate. It is up-regulated in estrogen receptor-negative breast cancers, melanoma and cervical cancers. Mutations in the gene encoding PHGDH are associated with Neu-Laxova syndrome. Down-regulation in PHGDH levels results in congenital microcephaly, psychomotor retardation and seizures.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)