SAB1402649

Monoclonal Anti-PIGS antibody produced in mouse

clone 3F3, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): DKFZp686K20216, FLJ45226
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3F3, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen ~33.7 kDa
• reatividade de espécies: mouse, human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bκ
• nº de adesão NCBI: NM_033198
• nº de adesão UniProt: Q96S52
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PIGS(94005)

Descrição

Descrição geral

This gene encodes a protein that is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. (provided by RefSeq)

Imunogênio

PIGS (NP_149975.1, 450 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable