Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

MSST0014

Sigma-Aldrich

SILuLite AMBP Alpha-1 Microglycoprotein human

recombinant, expressed in HEK 293 cells, MS protein standard

Sinônimo(s):

Alpha-1-microglobulin, Complex-forming glycoprotein heterogeneous in charge

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

50 μG
R$ 5.027,00

R$ 5.027,00


Check Cart for Availability

Solicite uma grande encomenda

Selecione um tamanho

Alterar visualização
50 μG
R$ 5.027,00

About This Item

Código UNSPSC:
23201100
NACRES:
NA.12

R$ 5.027,00


Check Cart for Availability

Solicite uma grande encomenda

fonte biológica

human

Nível de qualidade

recombinante

expressed in HEK 293 cells

etiqueta

His tagged

Ensaio

≥98% (SDS-PAGE)

Formulário

lyophilized powder

técnica(s)

mass spectrometry (MS): suitable

adequação

suitable for mass spectrometry (internal calibrator)

nº de adesão UniProt

temperatura de armazenamento

−20°C

Informações sobre genes

human ... AMBP(259)

Descrição geral

SILu Lite AMBP is a recombinant human protein expressed in human 293 cells. It is a monomer of 204 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~23 kDa. SILu Lite AMBP is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Ações bioquímicas/fisiológicas

AMBP is synthesized by the liver. Approximately half of the circulating protein is complexed to IgA. The free form of AMBP is filtered by the glomerulus and reabsorbed by proximal tubule cells.[1] AMBP has been found to be a sensitive biomarker for proximal tubular dysfunction even in the early phase of injury when no histologic damage is observable. In addition, urinary AMBP has been proposed to be a useful marker of tubular dysfunction even in low-gestational-age preterm infants, a population at high risk for AKI (Acute Kidney Injury). Urinary AMBP is also a marker of kidney damage in type 2 diabetes.[2]

Sequência

GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVDYKDDDDKGHHHHHHHHGGQ

forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Informações legais

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
SILu is a trademark of Sigma-Aldrich Co. LLC

Código de classe de armazenamento

11 - Combustible Solids

Classe de risco de água (WGK)

WGK 2

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Elisa Bellei et al.
The journal of headache and pain, 16, 559-559 (2015-08-15)
Medication-overuse headache (MOH) is a chronic disorder that results from the overuse of analgesics drugs, triptans or other acute headache compounds. Although the exact mechanisms underlying MOH remain still unknown, several studies suggest that it may be associated with development
Vishal S Vaidya et al.
Annual review of pharmacology and toxicology, 48, 463-493 (2007-10-17)
Acute kidney injury (AKI) is a common condition with a high risk of death. The standard metrics used to define and monitor the progression of AKI, such as serum creatinine and blood urea nitrogen levels, are insensitive, nonspecific, and change

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica