Pular para o conteúdo
Merck
Todas as fotos(5)

Documentos

HPA031700

Sigma-Aldrich

Anti-MB21D1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-C6orf150

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.43

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

sequência de imunogênio

RKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERF

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

Descrição geral

The gene MB21D1 (Mab-21 domain containing 1) is mapped to human chromosome 6q13. It is ubiquitously expressed.

Imunogênio

Uncharacterized protein C6orf150 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MB21D1 antibody produced in rabbit has been used in western blotting and immunofluorescence.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Ações bioquímicas/fisiológicas

MB21D1 (Mab-21 domain containing 1) is a cytosolic DNA sensor and is responsible for the immune activation. It is needed for interferon production via the STING (stimulator of interferon genes) pathway. DNA recognition by MB21D1 results in formation of 2′3′-cGAMP (cyclic guanosine monophosphate–adenosine monophosphate) which interacts with STING. These events lead to the activation of TBK1 (TANK-binding kinase 1), followed by activation of transcription factor IRF3 (interferon regulatory factor 3). MB21D1 also plays an important role in activation of interferons in presence of DNA virus (herpes simplex virus 1, vaccinia virus, adenovirus and retroviruses) infection. It is needed for the detection of Mycobacterium tuberculosis infection by macrophages and works as an innate immune sensor.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST77652

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Inhibition of cGAS DNA Sensing by a Herpesvirus Virion Protein.
Wu JJ, et al.
Cell host & microbe, 18, 333-344 (2015)
Cyclic GMP-AMP Synthase Is Required for Cell Proliferation and Inflammatory Responses in Rheumatoid Arthritis Synoviocytes.
Wang Y, et al.
Mediators of Inflammation, 2015, 192329-192329 (2015)
Knockout of cGAS and STING Rescues Virus Infection of Plasmid DNA-Transfected Cells.
Langereis MA, et al.
Journal of Virology, 89, 11169-11173 (2015)
Genomic markers of ovarian reserve.
Wood MA and Rajkovic A
Seminars in Reproductive Medicine, 31, 399-415 (2013)
Pan-viral specificity of IFN-induced genes reveals new roles for cGAS in innate immunity.
Schoggins JW, et al.
Nature, 505, 691-695 (2014)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica