Pular para o conteúdo
Merck
Todas as fotos(1)

Key Documents

HPA014722

Sigma-Aldrich

Anti-KCNJ5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-CIR, Anti-GIRK4, Anti-KATP1, Anti-Kir3.4, Anti-LQT13

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Número MDL:
MFCD07370456
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
HPA014722
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunohistochemistry: 1:500- 1:1000

sequência de imunogênio

TPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGG

nº de adesão UniProt

P48544

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... KCNJ5(3762)

Descrição geral

KCNJ5 (potassium channel, inwardly rectifying subfamily J, member 5) is an inward rectifier K+ channel 4, which is activated by G-protein. This protein is also called Kir3.4, and is expressed in zona glomerulosa, and forms either homotetramers or heterotetramers with Kir3.1 (KCNJ3), Kir3.2 (KCNJ6) or Kir3.3 (KCNJ9). The pore of this channel has a GYG motif at its narrowest position, which acts as a selectivity filter against K+. KCNJ5 contains four subunits, with each of them spanning the membrane twice. The pore is present in between the four subunits. This gene is localized to human chromosome 11q24.

Imunogênio

G protein-activated inward rectifier potassium channel 4 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Ações bioquímicas/fisiológicas

KCNJ5 (potassium channel, inwardly rectifying subfamily J, member 5) is a channel that acts as a filter to reduce the K+ selectivity of cells. This leads to the movement of Na+ ions inside the cell, causing depolarization, which eventually results in enhanced synthesis of aldosterone. Hyperpolarization of membrane by this channel leads to inhibition of prolactin secretion by pituitary lactotropes, when acted upon by dopamine. Mutations in this gene are associated with familial hyperaldosteronism type III (FH-III), and are also involved in the pathophysiology of sporadic aldosterone-producing adenomas. Polymorphisms in this gene are linked to common as well as rare forms of primary aldosteronism. Mutations in KCNJ5 might also be linked with unilateral adrenal hyperplasia. Polymorphisms in this gene are also associated with Tourette Syndrome (TS) and attention-deficit/hyperactivity disorder (ADHD).

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST72857

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Jingjing Zhang et al.
Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics, 32(1), 21-25 (2015-01-31)
To investigate the prevalence of KCNJ5 gene missense mutations and their role in patients with unilateral adrenal hyperplasia (UAH). Fourteen UAH tissues were collected through surgical resection, and all the tissues were confirmed by pathology. Peripheral blood samples of the
L Gomez et al.
Genes, brain, and behavior, 13(6), 535-542 (2014-05-21)
Linkage and association of Tourette Syndrome (TS) and Attention-Deficit/Hyperactivity Disorder (ADHD) have previously been reported in the 11q24 chromosomal region. To identify the risk gene within the region we studied the potassium inwardly-rectifying channel J5 (KCNJ5) gene in a sample
Silvia Monticone et al.
The Journal of clinical endocrinology and metabolism, 98(11), E1861-E1865 (2013-09-17)
Primary aldosteronism is a heterogeneous group of disorders comprising both sporadic and familial forms. Mutations in the KCNJ5 gene, which encodes the inward rectifier K(+) channel 4 (G protein-activated inward rectifier K(+) channel 4, Kir3.4), cause familial hyperaldosteronism type III
Meena Murthy et al.
Hypertension (Dallas, Tex. : 1979), 63(4), 783-789 (2014-01-15)
Primary aldosteronism (autonomous aldosterone production with suppressed renin) plays an important pathophysiological role in what has been previously labeled as essential hypertension. Besides the recently described germline mutations in the KCNJ5 potassium channel associated with familial primary aldosteronism, somatic mutations
Carolina Velarde-Miranda et al.
Clinical and experimental pharmacology & physiology, 40(12), 895-901 (2013-07-09)
The G-protein-activated inwardly rectifying potassium channel Kir3.4 is expressed in the zona glomerulosa cell membrane and transports potassium out of the cell.  Angiotensin II stimulation of aldosterone secretion is mediated, in part, by suppression of the transcription of KCNJ5, the

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica