Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

HPA005700

Sigma-Aldrich

Anti-MAPK3/ERK1 Antibody

Prestige Antibodies® Powered by Atlas Antibodies, rabbit polyclonal

Sinônimo(s):

Anti-ERK-1 antibody produced in rabbit, Anti-ERT2 antibody produced in rabbit, Anti-Extracellular signal-regulated kinase 1 antibody produced in rabbit, Anti-Insulin-stimulated MAP2 kinase antibody produced in rabbit, Anti-MAP kinase 1 antibody produced in rabbit, Anti-MAPK 1 antibody produced in rabbit, Anti-Microtubule-associated protein 2 kinase antibody produced in rabbit, Anti-Mitogen-activated protein kinase 3 antibody produced in rabbit, Anti-p44-ERK1 antibody produced in rabbit, Anti-p44-MAPK antibody produced in rabbit

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41
Preço e disponibilidade não estão disponíveis no momento.

Nome do produto

Anti-MAPK3 antibody produced in rabbit, Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

rat, human, mouse

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

sequência de imunogênio

EVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... MAPK3(5595)

Procurando produtos similares? Visita Guia de comparação de produtos

Descrição geral

Mitogen-activated protein kinase 3 (MAPK3) is a member of the MAP kinase family and is involved in various cell signalling pathways.

Imunogênio

Mitogen-activated protein kinase 3 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Ações bioquímicas/fisiológicas

Mitogen-activated protein kinase 3 (MAPK3) is involved actively in signaling modules through which cells transduce extracellular signals into intracellular responses. The different pathways have been associated with the regulation of cellular proliferation, differentiation, angiogenesis, embryo development and tumor invasion. In the Ras/extracellular signal-regulated kinase (ERK) pathway, the p90 ribosomal S6 kinases (RSKs) lie at the terminus of the ERK pathway. RSK activation by ERK requires its interaction through a docking site located near the C terminus of RSK. They form a complex which is further involved in activating and recruiting other proteins downstream for the pathway. In another pathway dealing with cell proliferation and differentiation, Raf phosphorylates and activates MEK1/2, which phosphorylates MAPK3 on Thr183 and Tyr185 in the activation loop resulting in full activation of MAPK3. Phosphorylation and de-phosphorylation of MAPK3 provides a rapid and reversible regulatory system to control its activity.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST86538

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Zhimin Lu et al.
Molecular cell, 9(5), 945-956 (2002-06-07)
ERK1/2 MAP kinases are important regulators in cellular signaling, whose activity is normally reversibly regulated by threonine-tyrosine phosphorylation. In contrast, we have found that stress-induced ERK1/2 activity is downregulated by ubiquitin/proteasome-mediated degradation of ERK1/2. The PHD domain of MEKK1, a
Philippe P Roux et al.
Molecular and cellular biology, 23(14), 4796-4804 (2003-07-02)
Stimulation of the Ras/extracellular signal-regulated kinase (ERK) pathway can modulate cell growth, proliferation, survival, and motility. The p90 ribosomal S6 kinases (RSKs) comprise a family of serine/threonine kinases that lie at the terminus of the ERK pathway. Efficient RSK activation

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica