Pular para o conteúdo
Merck
Todas as fotos(8)

Documentos Principais

HPA004832

Sigma-Aldrich

Anti-ARPC1B antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-Actin-related protein 2/3 complex subunit 1B, Anti-Arp2/3 complex 41 kDa subunit, Anti-p41-ARC

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 4.567,00

R$ 4.567,00

Check Cart for Availability
Todas as fotos(8)

Selecione um tamanho

Alterar visualização
100 μL
R$ 4.567,00

About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
HPA004832
NACRES:
NA.43

R$ 4.567,00

Check Cart for Availability

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human, mouse, rat

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

sequência de imunogênio

TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA

nº de adesão UniProt

O15143

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ARPC1B(10095)

Categorias relacionadas

Descrição geral

The Arp2/3 complex is composed of seven subunits, such as Arp2, Arp3, p41-Arc, p34-Arc, p21-Arc, p20-Arc, and p16-Arc (p complex). Among all the subunits, ARPC1B is a novel member of the Sop2 family of WD (tryptophan and aspartate) repeat-containing proteins.

Imunogênio

Actin-related protein 2/3 complex subunit 1B recombinant protein epitope signature tag (PrEST)

Aplicação

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Ações bioquímicas/fisiológicas

ARPC1B (actin related protein 2/3 complex, subunit 1B, 41kDa) is involved in the formation of actin filamentous network at the cell cortex. The protein subunit (ARPC1B) may maintain the structure and activity of the Arp2/3 complex. Overexpression of p41-Arc, a regulatory component of Arp2/3 complex causes the alteration of actin filaments. It gets accumulated in nuclei. Further, this alteration can trigger an intrinsic premature senescence in the tumor suppression process.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST86831

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
R07428

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Yaser Gamallat et al.
International journal of molecular sciences, 23(3) (2022-02-16)
ARPC1B (Actin Related Protein 2/3 Complex Subunit 1B) has been found to be involved in platelet abnormalities of immune-mediated inflammatory disease and eosinophilia. However, its role in prostate cancer (PCa) has not been established. We characterized the role of ARPC1B
Annabelle G Small et al.
Frontiers in immunology, 13, 840510-840510 (2022-03-24)
The phagocytosis-promoting complement receptor, Complement Receptor Immunoglobulin (CRIg), is exclusively expressed on macrophages. It has been demonstrated that expression in macrophages could be modulated by inflammatory mediators, including cytokines. This raised the possibility that a major phagocyte, the neutrophil, may
Yolla German et al.
Cell reports, 36(1), 109318-109318 (2021-07-08)
The immunological synapse is a complex structure that decodes stimulatory signals into adapted lymphocyte responses. It is a unique window to monitor lymphocyte activity because of development of systematic quantitative approaches. Here we demonstrate the applicability of high-content imaging to
Gabriella Leung et al.
JCI insight, 6(23) (2021-10-22)
Immune cells exhibit low-level, constitutive signaling at rest (tonic signaling). Such tonic signals are required for fundamental processes, including the survival of B lymphocytes, but when they are elevated by genetic or environmental causes, they can lead to autoimmunity. Events
Dawei Wang et al.
eLife, 10 (2021-11-20)
Actin filaments (F-actin) have been implicated in various steps of endosomal trafficking, and the length of F-actin is controlled by actin capping proteins, such as CapZ, which is a stable heterodimeric protein complex consisting of α and β subunits. However
Exibir todos os documentos relacionados

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica