HPA001758

Anti-SOX9 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): SOX9 Antibody - Anti-SOX9 antibody produced in rabbit, Sox9 Antibody, Anti-Transcription factor SOX-9 antibody produced in rabbit
• Número MDL: MFCD03792047
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA001758
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: recombinant expression; orthogonal RNAseq; RNAi knockdown; Learn more about Antibody Enhanced Validation
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• sequência de imunogênio: SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
• nº de adesão UniProt: P48436
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SOX9(6662)

Descrição

Descrição geral

The sex determining region Y-box 9 (SOX9) gene is mapped to human chromosome 17q24.3. This gene is expressed mainly in adult tissues and also in fetal testis and skeletal tissue. It consists of two functional domains: a high-mobility group (HMG) DNA-binding domain and a C-terminal transactivation domain.

Imunogênio

Transcription factor SOX-9 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-SOX9 antibody produced in rabbit has been used in immunohistochemistry and immunofluorescence

Anti-SOX9 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

SOX9, (sex determining region Y-box 9) a transcription factor, is associated with the testis-determining factor sex determining region Y (SRY). It plays a major role in cartilage differentiation and early testis development. It has been reported that SOX9 might play a role in chondrogenesis. Mutation of SOX9 gene in human causes campomelic dysplasia, a severe dwarfism syndrome and autosomal XY sex reversal.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST84775

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)