Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos Principais

AV46079

Sigma-Aldrich

Anti-PPAT antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-ATASE, Anti-GPAT, Anti-PRAT, Anti-Phosphoribosyl pyrophosphate amidotransferase

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 3.345,00

R$ 3.345,00


Check Cart for Availability


Selecione um tamanho

Alterar visualização
100 μL
R$ 3.345,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 3.345,00


Check Cart for Availability

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

56 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... PPAT(5471)

Descrição geral

Phosphoribosyl pyrophosphate amidotransferase/glutamine phosphoribosyl pyrophosphate amidotransferase (PPAT, PRAT, ATASE, GPAT) catalyzes the first committed step in de novo purine biosynthesis by converting α-phosphoribosylpyrophosphate (α-PRPP) into 5-β-phosphoribosylamine. Phosphoribosylamine (PRA) is the first intermediate in the common purine/thiamine biosynthetic pathway.

Especificidade

Anti-PPAT polyclonal antibody reacts with bovine, rat, canine, and human phosphoribosyl pyrophosphate amidotransferase/glutamine phosphoribosyl pyrophosphate amidotransferase enzymes.

Imunogênio

Synthetic peptide directed towards the N terminal region of human PPAT

Aplicação

Anti-PPAT polyclonal antibody is used to tag phosphoribosyl pyrophosphate amidotransferase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of phosphoribosyl pyrophosphate amidotransferase in purine/pyrimidine biosynthesis.

Ações bioquímicas/fisiológicas

PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. This gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Sequência

Synthetic peptide located within the following region: VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica