AV33177

Anti-TBX20 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-T-box 20
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• forma do anticorpo: affinity isolated antibody
• Nível de qualidade: 100
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 49 kDa
• reatividade de espécies: horse, human, rabbit, dog, mouse, rat, bovine, pig
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_001071121
• nº de adesão UniProt: Q9UMR3
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TBX20(57057)

Descrição

Imunogênio

Synthetic peptide directed towards the N terminal region of human TBX20

Ações bioquímicas/fisiológicas

TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating a possible role in regulating development of these tissues.

Sequência

Synthetic peptide located within the following region: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable