Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos

AV100776

Sigma-Aldrich

Anti-TCF4 (AB2) antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-E2-2, Anti-ITF2, Anti-SEF2, Anti-SEF2-1, Anti-SEF2-1A, Anti-SEF2-1B, Anti-Transcription factor 4

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

71 kDa

reatividade de espécies

pig, rat, human, mouse, horse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_001077431

nº de adesão UniProt

P15884

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... TCF4(6925)

Categorias relacionadas

Descrição geral

TCF-4 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway.

Imunogênio

Synthetic peptide directed towards the N terminal region of human TCF4

Aplicação

Anti-TCF4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.

Ações bioquímicas/fisiológicas

TCF-4 mediates the transformation of epithelial cells of colon in the absence of APC gene expression. The expression of TCF-4 is required to establish the proliferative progenitors to form the crypts of embryonic small intestine. TCF-4 collaborates with β-catenin to regulate the colorectal transformation process. Lack of TCF-4 expression results in developmental delay and intellectual disability termed as Pitt-Hopkins syndrome.

Sequência

Synthetic peptide located within the following region: DGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCH

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

J David Sweatt
Experimental & molecular medicine, 45, e21-e21 (2013-05-04)
TCF4 (transcription factor 4; E2-2, ITF2) is a transcription factor that when haplo-insufficient causes Pitt-Hopkins Syndrome (PTHS), an autism-spectrum disorder that is associated with pervasive developmental delay and severe intellectual disability. The TCF4 gene is also a risk factor with
Marc van de Wetering et al.
Cell, 111(2), 241-250 (2002-11-01)
The transactivation of TCF target genes induced by Wnt pathway mutations constitutes the primary transforming event in colorectal cancer (CRC). We show that disruption of beta-catenin/TCF-4 activity in CRC cells induces a rapid G1 arrest and blocks a genetic program
V Korinek et al.
Nature genetics, 19(4), 379-383 (1998-08-11)
Mutations of the genes encoding APC or beta-catenin in colon carcinoma induce the constitutive formation of nuclear beta-catenin/Tcf-4 complexes, resulting in activated transcription of Tcf target genes. To study the physiological role of Tcf-4 (which is encoded by the Tcf7/2

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica