Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos

AV32048

Sigma-Aldrich

Anti-CNOT2 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-CCR4-NOT transcription complex, subunit 2

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

40 kDa

reatividade de espécies

dog, rabbit, mouse, bovine, human, rat, horse, guinea pig

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_055330

nº de adesão UniProt

Q9NZN8-2

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CNOT2(4848)

Descrição geral

CNOT2 forms a part of the transcriptional regulator, the Ccr4-Not complex, and can repress promoter functions. Studies have reported that depletion of CNOT2 inhibits CCR4-NOT deadenylase and causes apoptosis in cells. Furthermore, the SMRT/NCoR-HDAC3 complex is known to be a cofactor of CNOT2-mediated transcriptional repression.
Rabbit Anti-CNOT2 antibody recognizes bovine, human, mouse, rat, canine, and chicken CNOT2.

Imunogênio

Synthetic peptide directed towards the middle region of human CNOT2

Aplicação

Rabbit Anti-CNOT2 antibody can be used for western blot applications at a concentration of 1.25μg/ml.

Ações bioquímicas/fisiológicas

CNOT2 is one of the subunits of the CCR4-NOT complex,which functions as general transcription regulation complex.

Sequência

Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Sandrine Jayne et al.
The Biochemical journal, 398(3), 461-467 (2006-05-23)
In eukaryotic cells, the Ccr4-Not complex can regulate mRNA metabolism at various levels. Previously, we showed that promoter targeting of the CNOT2 subunit resulted in strong repression of RNA polymerase II transcription, which was sensitive to the HDAC (histone deacetylase)
Carin G M Zwartjes et al.
The Journal of biological chemistry, 279(12), 10848-10854 (2004-01-07)
The evolutionary conserved Ccr4-Not complex controls mRNA metabolism at multiple levels in eukaryotic cells. Genetic analysis of not mutants in yeast identifies a negative role in transcription, which is dependent on core promoter structure. To obtain direct support for this
Kentaro Ito et al.
Genes to cells : devoted to molecular & cellular mechanisms, 16(4), 368-379 (2011-02-09)
Eukaryotic mRNA decay is initiated by shortening of the poly (A) tail; however, neither the molecular mechanisms underlying deadenylation nor its regulation is well understood. The human CCR4-NOT complex is a major cytoplasmic deadenylase consisting of a combination of at

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica