Direkt zum Inhalt
Merck

WH0008192M1

Sigma-Aldrich

Monoclonal Anti-CLPP antibody produced in mouse

clone 300, purified immunoglobulin, buffered aqueous solution

Synonym(e):

Anti-ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise

Größe auswählen

100 μG
€ 492,00

€ 492,00


Versand innerhalb von 2 Wochen. (Bei Bestellungen außerhalb der USA und Europas rechnen Sie bitte zusätzlich 1–2 Wochen für die Lieferung ein.)


Größe auswählen

Ansicht ändern
100 μG
€ 492,00

About This Item

UNSPSC-Code:
12352203
NACRES:
NA.41

€ 492,00


Versand innerhalb von 2 Wochen. (Bei Bestellungen außerhalb der USA und Europas rechnen Sie bitte zusätzlich 1–2 Wochen für die Lieferung ein.)

Biologische Quelle

mouse

Konjugat

unconjugated

Antikörperform

purified immunoglobulin

Antikörper-Produkttyp

primary antibodies

Klon

300, monoclonal

Form

buffered aqueous solution

Speziesreaktivität

rat, human, mouse

Methode(n)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotyp

IgG2bκ

GenBank-Hinterlegungsnummer

UniProt-Hinterlegungsnummer

Versandbedingung

dry ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... CLPP(8192)

Allgemeine Beschreibung

CLPP (caseinolytic mitochondrial matrix peptidase proteolytic subunit) protein contains an aqueous chamber formed by face-to-face assembly of the two heptameric rings that have proteolytic active sites within. It is a member of the peptidase family S14. The CLPP gene is localized to human chromosome 19p13.3.

Immunogen

CLPP (NP_006003, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

Anwendung

Monoclonal Anti-CLPP antibody produced in mouse has been used in Western Blotting.

Biochem./physiol. Wirkung

CLPP (caseinolytic mitochondrial matrix peptidase proteolytic subunit) gene encodes a protease component of the Clp complex that hydrolyzes peptides and various proteins in the presence of ATP. The protein requires magnesium for its activity. CLPP is found to be associated with the inner mitochondrial membrane.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable

Persönliche Schutzausrüstung

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Perrault syndrome is caused by recessive mutations in CLPP, encoding a mitochondrial ATP-dependent chambered protease
Emma M Jenkinson
American Journal of Human Genetics, 92 (2013)
Ablation of the mitochondrial complex IV assembly protein Surf1 leads to increased expression of the UPRMT and increased resistance to oxidative stress in primary cultures of fibroblasts
Gavin Pharaoh
Redox Biology (2016)
Crystallography and mutagenesis point to an essential role for the N-terminus of human mitochondrial ClpP
Sung Gyun Kang
Journal of Structural Biology, 148 (2004)
Gavin Pharaoh et al.
Redox biology, 8, 430-438 (2016-05-22)
Mice deficient in the electron transport chain (ETC) complex IV assembly protein SURF1 have reduced assembly and activity of cytochrome c oxidase that is associated with an upregulation of components of the mitochondrial unfolded protein response (UPR(MT)) and increased mitochondrial
Shylesh Bhaskaran et al.
EMBO reports, 19(3) (2018-02-09)
Caseinolytic peptidase P (ClpP) is a mammalian quality control protease that is proposed to play an important role in the initiation of the mitochondrial unfolded protein response (UPRmt), a retrograde signaling response that helps to maintain mitochondrial protein homeostasis. Mitochondrial

Questions

Reviews

No rating value

Active Filters

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.