Fortfahren mit
MSST0062
SILu™Lite APOD, Apolipoprotein D human
recombinant, expressed in HEK 293 cells, MS Protein Standard, ≥95% (SDS-PAGE)
Synonym(e):
Apo-D, ApoD
zur Ansicht der Organisations- und Vertragspreise.
Größe auswählen
Ansicht ändern
| Ihnen/SKU | Verfügbarkeit | Preis |
|---|---|---|
50 μg | Warenkorb auf Verfügbarkeit prüfen | € 710,00 |
Über diesen Artikel
NACRES:
NA.24
UNSPSC Code:
23201100
Form:
lyophilized powder
Assay:
≥95% (SDS-PAGE)
Recombinant:
expressed in HEK 293 cells
Technischer Dienst
Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.
Unterstützung erhaltenGeneral description
SILu™Lite APOD is a recombinant human protein expressed in human 293 cells. It consists of 189 amino acids (including a C-terminal polyhistidine tag), with a calculated molecular mass of 21.69 kDa. SILu™Lite APOD is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.
Other Notes
QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
1 of 1
Dieser Artikel | |||
|---|---|---|---|
| assay ≥95% (SDS-PAGE) | assay ≥98% (SDS-PAGE) | assay ≥95% (SDS-PAGE) | assay ≥98% (SDS-PAGE) |
| recombinant expressed in HEK 293 cells | recombinant expressed in HEK 293 cells | recombinant expressed in HEK 293 cells | recombinant expressed in HEK 293 cells |
| form lyophilized powder | form lyophilized powder | form lyophilized powder | form lyophilized powder |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
| UniProt accession no. | UniProt accession no. | UniProt accession no. | UniProt accession no. |
| Gene Information human ... APOD(347) | Gene Information human ... AMBP(259) | Gene Information human ... CXCL8(3576) | Gene Information human ... ALB(213) |
Lagerklasse
11 - Combustible Solids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Hier finden Sie alle aktuellen Versionen:
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.