MSST0062

SILu^™Lite APOD, Apolipoprotein D human

recombinant, expressed in HEK 293 cells, MS Protein Standard, ≥95% (SDS-PAGE)

• Synonym(e): Apo-D, ApoD
• UNSPSC-Code: 23201100
• NACRES: NA.24

Eigenschaften

• Rekombinant: expressed in HEK 293 cells
• Qualitätsniveau: 200
• Assay: ≥95% (SDS-PAGE)
• Form: lyophilized powder
• UniProt-Hinterlegungsnummer: P05090
• Versandbedingung: ambient
• Lagertemp.: −20°C
• Angaben zum Gen: human ... APOD(347)

Beschreibung

Allgemeine Beschreibung

SILu^™Lite APOD is a recombinant human protein expressed in human 293 cells. It consists of 189 amino acids (including a C-terminal polyhistidine tag), with a calculated molecular mass of 21.69 kDa. SILu^™Lite APOD is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Biochem./physiol. Wirkung

Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.

Sequenz

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ

Physikalische Form

Supplied as a lyophilized powder containing phosphate buffered saline.

Rechtliche Hinweise

SILu is a trademark of Sigma-Aldrich Co. LLC

Sicherheitshinweise

• Lagerklassenschlüssel: 11 - Combustible Solids
• WGK: WGK 2
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable