HPA022040

Anti-RUNX2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-Acute myeloid leukemia 3 protein, Anti-CBF-alpha-1, Anti-Core-binding factor subunit alpha-1, Anti-OSF-2, Anti-Oncogene AML-3, Anti-PEA2-alpha A, Anti-PEBP2-alpha A, Anti-Polyomavirus enhancer-binding protein 2 alpha A subunit, Anti-Runt-related transcription factor 2, Anti-SL3-3 enhancer factor 1 alpha A subunit, Anti-SL3/AKV core-binding factor alpha A subunit
• MDL-Nummer: MFCD07370486
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA022040
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: RNAi knockdown; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Immunogene Sequenz: LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
• UniProt-Hinterlegungsnummer: Q13950
• Anwendung(en): research pathology
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... RUNX2(860)

Beschreibung

Allgemeine Beschreibung

Runt-related transcription factor 2/acute myeloid leukemia 3 protein (RUNX2, AML-3) belongs to Runt DNA-binding domain transcription factor family. RUNX2 gene is mapped to human chromosome 6p21.1 RUNX2 possesses the Runt domain, nuclear localization signal (NLS), the nuclear matrix targeting signal (NMTS) and a C-terminal VWRPY sequence. It also has two additional domains, one being the N-terminal glutamine-alanine (QA) repeats and the other a C-terminal proline/serine/threonine (PST) rich tract. RUNX2 exists in two isoforms. The isoform 1 is expressed in osteoblasts and the isoform 2 is distributed in mesenchymal condensations and mature chondrocytes.

Spezifität

Rabbit polyclonal anti-RUNX2 antibody reacts with human runt-related transcription factor 2/Acute myeloid leukemia 3 protein.

Immunogen

Runt-related transcription factor 2 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-RUNX2 antibody produced in rabbit has been used in immunohistochemistry and immunofluorescence.

Rabbit polyclonal anti-RUNX2 antibody is used to tag Runt-related transcription factor 2/Acute myeloid leukemia 3 protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of runt-related transcription factor 2/Acute myeloid leukemia 3 protein in osteoblast differentiation and skeletal morphogenesis.

Biochem./physiol. Wirkung

Runt-related transcription factor 2/ acute myeloid leukemia 3 protein (RUNX2, AML-3) mediates osteoblast differentiation and skeletal morphogenesis. It promotes mesenchymal cell differentiation in osteoblasts and its maturation. Elevated levels of RUNX2 is observed in bone?metastatic cancers. The post-translational modifications like phosphorylation, methylation, glycosylation and ubiquitination in the RUNX2 modulates osteogenesis. Mutations in the RUNX2 gene leading to loss of function is implicated in cleidocranial dysplasia (CCD). The levels of RUNX2 is elevated in osteosarcoma.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST86701

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable