HPA005478

Anti-EZH1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-ENX-2, Anti-Enhancer of zeste homolog 1, Anti-Histone-lysine N-methyltransferase EZH1
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA005478

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect immunofluorescence: suitable
• Immunogene Sequenz: MGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNA
• UniProt-Hinterlegungsnummer: Q92800
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... EZH1(2145)

Beschreibung

Allgemeine Beschreibung

Enhancer of zeste homolog 1 (EZH1) is a part of non-canonical PRC2 (Polycomb repressive complex), and is an H3K27 methyltransferase. It localizes to chromatin. It is expressed ubiquitously, with high expression profiles in skeletal muscle, brain and kidney. It is expressed in adult and fetal tissues as two major transcripts. EZH1 protein is composed of 747 amino acids. In humans, this gene is located on chromosome 17.

Immunogen

enhancer of zeste 1 polycomb repressive complex 2 subunit

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem./physiol. Wirkung

Enhancer of zeste homolog 1 (EZH1) mediates PRC2 complex activity, which in turn is responsible for the induction and maintainance of gene respression. PRC2 is recruited to chromatin, where EZH1 helps it to catalyze the trimethylation of histone H3 (H3K27me3), on its lysine 27 residue. This protein also promotes mRNA transcription by facilitating RNA polymerase II elongation. Since EZH1 is a histone methyltransferase, it maintains the undifferentiated state of hematopoietic stem cells (HSC) and prevents their senescence. Inactivation of this gene leads to degeneration of hair follicles as the proliferation of hair follicle stem cells is inhibited. In epidermal stem cells, EZH1 represses the differentiation of Merkel stem cell lineage.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST86929

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)