WH0064399M1

Monoclonal Anti-HHIP antibody produced in mouse

clone 5D11, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-FLJ20992, Anti-FLJ90230, Anti-HIP, Anti-hedgehog interacting protein
• Numer MDL: MFCD01094561
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 5D11, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: rat, human, mouse
• metody: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2bκ
• numer dostępu GenBank: NM_022475
• numer dostępu UniProt: Q96QV1
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... HHIP(64399)

Opis

Opis ogólny

This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. (provided by RefSeq)

Immunogen

HHIP (NP_071920, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ

Zastosowanie

Monoclonal Anti-HHIP antibody produced in mouse has been used in immnohistochemistry.

Działania biochem./fizjol.

The gene encoding HHIP (hedgehog interacting protein) is located on human chromosome 4, and encodes for a protein belonging to the hedgehog-interacting protein (HHIP) family. Hedgehog (HH) proteins are evolutionarily conserved proteins, and are important morphogens for a vast range of developmental processes, like regulation of left-right asymmetry and anteroposterior patterns of limbs during embryonic development. HH signals are regulated by numerous cell-surface receptors. HHIP encoded by this gene is highly conserved and interacts with all the three HH family members namely SHH (sonic hh), IHH (indian hh) and DHH (desert hh). It is also a vertebrate-specific inhibitor of HH signaling. Single nucleotide polymorphisms (SNPs) in HHIP gene is associated with increase in the risk of chronic obstructive pulmonary disease (COPD).

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): nwg
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)