Przejdź do zawartości
Merck
Wszystkie zdjęcia(6)

Dokumenty

WH0007001M1

Sigma-Aldrich

Monoclonal Anti-PRDX2 antibody produced in mouse

clone 4E10-2D2, purified immunoglobulin, buffered aqueous solution

Synonim(y):

Anti-MGC4104, Anti-NKEFB, Anti-PRP, Anti-PRXII, Anti-Peroxiredoxin 2, Anti-TDPX1, Anti-TSA

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(6)

About This Item

Numer MDL:
MFCD00162725
Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

4E10-2D2, monoclonal

Postać

buffered aqueous solution

reaktywność gatunkowa

human

metody

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

izotyp

IgG1κ

numer dostępu GenBank

BC000452

numer dostępu UniProt

P32119

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... PRDX2(7001)

Opis ogólny

Peroxiredoxin 2 (PRDX2) is an antioxidant protein that belongs to the peroxiredoxins family. It is associated with mammalian erythrocytes. The PRDX2 gene is mapped to human chromosome19p13.13.

Immunogen

PRDX2 (AAH00452, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Zastosowanie

Monoclonal Anti-PRDX2 antibody produced in mouse has been used in western blotting (1:1000).

Działania biochem./fizjol.

Peroxiredoxin 2 (PRDX2) effectively neutralizes hydrogen peroxide (H2O2 ). It is regarded as a critical cell survival modulator and may serve as a key regulator for cell proliferation and intracellular signaling. Downregulated expression of PRDX2 is observed in acute myeloid leukemia (AML) and melanoma. However, it acts as an oncogene in the pathophysiology of various cancers including non-small cell lung cancer (NSCLC), esophageal, cervical, gastric tumors, and many more.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Not finding the right product?  

Try our Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Ting Duan et al.
Molecular medicine reports, 13(6), 4807-4813 (2016-04-16)
Late‑onset hypogonadism is defined as a condition caused by a decline in the levels of testosterone with aging. One of the major factors contributing to the low levels of testosterone is the accumulation of reactive oxygen species (ROS) in Leydig
Yun Chen et al.
BioMed research international, 2020, 8359860-8359860 (2020-09-11)
Previous studies have reported that the levels of PRDX2 were correlated with tumorigenicity, recurrence, and prognosis of patients with different cancers. We investigated the association between PRDX2 levels and the prognosis of lung cancer patients. We also measured PRDX2 expression
Kumarasamypet M Mohankumar et al.
Nature genetics, 47(8), 878-887 (2015-06-16)
Cancers are characterized by non-random chromosome copy number alterations that presumably contain oncogenes and tumor-suppressor genes (TSGs). The affected loci are often large, making it difficult to pinpoint which genes are driving the cancer. Here we report a cross-species in
Sarah Kishinevsky et al.
Nature communications, 9(1), 4345-4345 (2018-10-21)
Environmental and genetic risk factors contribute to Parkinson's Disease (PD) pathogenesis and the associated midbrain dopamine (mDA) neuron loss. Here, we identify early PD pathogenic events by developing methodology that utilizes recent innovations in human pluripotent stem cells (hPSC) and
Trung Nghia Vo et al.
Antioxidants (Basel, Switzerland), 10(7) (2021-07-03)
Hydrogen peroxide (H2O2) is a key redox signaling molecule that selectively oxidizes cysteines on proteins. It can accomplish this even in the presence of highly efficient and abundant H2O2 scavengers, peroxiredoxins (Prdxs), as it is the Prdxs themselves that transfer
Wyświetl wszystkie powiązane dokumenty

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej