WH0004695M1

Monoclonal Anti-NDUFA2 antibody produced in mouse

clone 6E7, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-B8, Anti-CD14, Anti-NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 6E7, monoclonal
• Formularz: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu GenBank: NM_002488
• numer dostępu UniProt: O43678
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NDUFA2(4695)

Opis

Opis ogólny

The NDUFA2 gene encodes one of the accessory subunits of complex I, the first and largest complex of the mitochondrial respiratory chain (Hoefs et al., 2008 [PubMed 18513682]). For a discussion of complex I, see MIM 516000.[supplied by OMIM

Immunogen

NDUFA2 (NP_002479, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)