WH0002629M1
Monoclonal Anti-GBA antibody produced in mouse
clone 2e2, purified immunoglobulin, buffered aqueous solution
Synonim(y):
Anti-GBA1, Anti-GCB, Anti-GLUC, Anti-glucosidase, beta; acid (includes glucosylceramidase)
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wybierz wielkość
100 μG
2220,00 zł
2220,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Rekombinowane, niezawierające konserwantów przeciwciało jest dostępne dla Twojego celu. Wypróbuj ZRB1325
Wybierz wielkość
Zmień widok
100 μG
2220,00 zł
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
2220,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Rekombinowane, niezawierające konserwantów przeciwciało jest dostępne dla Twojego celu. Wypróbuj ZRB1325
Polecane produkty
pochodzenie biologiczne
mouse
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
purified immunoglobulin
rodzaj przeciwciała
primary antibodies
klon
2e2, monoclonal
Formularz
buffered aqueous solution
reaktywność gatunkowa
human
metody
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
izotyp
IgG2aκ
numer dostępu GenBank
numer dostępu UniProt
Warunki transportu
dry ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... GBA(2629)
Powiązane kategorie
Opis ogólny
GBA (β-glucocerebrosidase) gene is mapped to human chromosome 1q21. It is a lysosomal enzyme and is widely expressed. The protein has domain I with three‐stranded anti‐parallel β‐sheets, domain II with two β‐sheets making an immunoglobulin‐like domain and domain III with eight‐stranded β/αtriosephosphate isomerase (TIM) barrel.
This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants encoding the same protein. (provided by RefSeq)
Immunogen
GBA (NP_000148, 146 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS
Sequence
SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS
Zastosowanie
Monoclonal Anti-GBA antibody has been used in immunofluorescence staining.
Działania biochem./fizjol.
GBA (β-glucocerebrosidase) is responsible for the conversion of the glycolipid glucocerebroside to ceramide and glucose. Mutations in this gene are associated with Gaucher disease and Parkinson disease.
Postać fizyczna
Solution in phosphate buffered saline, pH 7.4
Informacje prawne
GenBank is a registered trademark of United States Department of Health and Human Services
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
polecane
Kod klasy składowania
10 - Combustible liquids
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Wybierz jedną z najnowszych wersji:
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Altered Differentiation Potential of Gaucher?s Disease iPSC Neuronal Progenitors due to Wnt/b-Catenin Downregulation
Awad O, et al.
Stem Cell Reports, 9 (2017)
Stefania Zampieri et al.
International journal of molecular sciences, 22(11) (2021-06-03)
Gaucher disease (GD) is an autosomal recessive lysosomal disorder due to beta-glucosidase gene (GBA) mutations. The molecular diagnosis of GD is complicated by the presence of recombinant alleles originating from a highly homologous pseudogene. Clinical exome sequencing (CES) is a
Leelamma M Panicker et al.
Human molecular genetics, 27(5), 811-822 (2018-01-05)
Gaucher disease (GD) is caused by bi-allelic mutations in GBA1, the gene that encodes acid β-glucocerebrosidase (GCase). Individuals affected by GD have hematologic, visceral and bone abnormalities, and in severe cases there is also neurodegeneration. To shed light on the
The relationship between glucocerebrosidase mutations and Parkinson disease
Migdalska-Richards A and Schapira AH
Journal of Neurochemistry (2016)
Rodolfo Tonin et al.
Journal of neurology, 266(1), 92-101 (2018-11-02)
Patients with Gaucher Disease (GD) exhibit three phenotypes, including type 1 (non-neuronopathic), type 2 (acute neuronopathic), and type 3 (subacute neuronopathic). Identifying which GBA changes represent benign polymorphisms and which may result in disease-causing mutations is essential for diagnosis and
Active Filters
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej
