Przejdź do zawartości
Merck

MSST0058

Sigma-Aldrich

SILuLite IL8, Interleukin-8 human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Synonim(y):

C-X-C motif chemokine 8, Chemokine (C-X-C motif), Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), IL-8, Monocyte-derived neutrophil, Monocyte-derived neutrophil-activating peptide (MONAP), Neutrophil-activating protein 1 (NAP-1), Protein 3-10C, T-cell chemotactic factor, chemotactic factor (MDNCF), ligand 8

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
23201100
NACRES:
NA.32

rekombinowane

expressed in HEK 293 cells

Poziom jakości

Próba

≥95% (SDS-PAGE)

Postać

lyophilized powder

przydatność

suitable for mass spectrometry (internal calibrator)

numer dostępu UniProt

Warunki transportu

ambient

temp. przechowywania

−20°C

informacje o genach

human ... CXCL8(3576)

Opis ogólny

SILuLite IL8 is a recombinant human protein expressed in human 293 cells. It is a mixture of the 3 main CXCL8 isoforms with the molecular weights, amino acid number and relative abundance as described in Table 1 of the product datasheet. SILuLite IL8 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Działania biochem./fizjol.

Interleukin-8 (IL-8) is a member of the CXC chemokine subfamily and is produced by blood cells and many types of tissues. The measurement of IL-8 in voided urinary samples may have utility for urine-based detection of bladder cancer. Urinary IL-8 was a strong biomarker of stress under intensive and prolonged demands, both acutely and over time. IL-8 and cathepsin B levels were significantly elevated in melanoma patients, and more importantly, the combination of IL-8 and cathepsin B were also studied as a prognosis marker for melanoma mortality.

Sekwencja

EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Postać fizyczna

Supplied as a lyophilized powder containing phosphate buffered saline.

Informacje prawne

SILu is a trademark of Sigma-Aldrich Co. LLC
Ta strona może zawierać tekst przetłumaczony maszynowo.

Kod klasy składowania

11 - Combustible Solids

Klasa zagrożenia wodnego (WGK)

WGK 2

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej