Przejdź do zawartości
Merck

MSST0005

Sigma-Aldrich

SILuProt VEGFA Vascular endothelial growth factor A human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C- and 15N-labeled

Synonim(y):

SILuProt Vascular endothelial growth factor A

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych

Wybierz wielkość

10 μG
3160,00 zł

3160,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności

Poproś o zamówienie zbiorcze

Wybierz wielkość

Zmień widok
10 μG
3160,00 zł

About This Item

Kod UNSPSC:
23201100
NACRES:
NA.12

3160,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności

Poproś o zamówienie zbiorcze

pochodzenie biologiczne

human

Poziom jakości

rekombinowane

expressed in HEK 293 cells

Próba

≥95% (SDS-PAGE)

Formularz

lyophilized powder

metody

mass spectrometry (MS): suitable

numer dostępu UniProt

temp. przechowywania

−20°C

informacje o genach

human ... VEGFA(7422)

Opis ogólny

SILu Prot VEGF165 is a recombinant, stable isotope-labeled human VEGF165 which incorporates [13C6,15N4]−Arginine and [13C6, 15N2]−Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of VEGF165 by mass-spectrometry.

Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Działania biochem./fizjol.

VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure1. VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration2.
VEGF has also been implicated in correlation with poor prognosis in breast cancer2. In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4.

Sekwencja

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC

Postać fizyczna

Supplied as a lyophilized powder containing phosphate buffered saline

Informacje prawne

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice),1-302-695-1437 (fax), [email protected].
SILu is a trademark of Sigma-Aldrich Co. LLC
Ta strona może zawierać tekst przetłumaczony maszynowo.

Kod klasy składowania

11 - Combustible Solids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Questions

Reviews

No rating value

Active Filters

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej