Przejdź do zawartości
Merck
Wszystkie zdjęcia(7)

Kluczowe dokumenty

HPA012323

Sigma-Aldrich

Anti-CSF1R antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

Przeciwciało CSF1R - przeciwciało anty-CSF1R produkowane u królików, Przeciwciało Csf1R

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Numer MDL:
Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Formularz

buffered aqueous glycerol solution

reaktywność gatunkowa

human

rozszerzona walidacja

recombinant expression
Learn more about Antibody Enhanced Validation

metody

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

sekwencja immunogenna

NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... CSF1R(1436)

Opis ogólny

CSF1R (Colony stimulating factor 1 receptor), a type III receptor tyrosine kinase, is a member of the platelet-derived growth factor (PDGF) receptor family. Structurally, it is composed of five immunoglobulin-like domains, a transmembrane domain, a juxtamembrane domain (JM) and a protein kinase domain separated into two parts by an insert domain (KID).
CSF1R is located on human chromosome 5q32.

Immunogen

Macrophage colony-stimulating factor 1 receptor precursor recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-CSF1R antibody has been used:
  • in cell lysis
  • in immunoprecipitation
  • in western blotting
  • in immunohistochemical analysis

Działania biochem./fizjol.

CSF1R (Colony stimulating factor 1 receptor) is a major molecule in the innate immunity, cancer, and inflammatory diseases, including systemic lupus erythematosus, arthritis, atherosclerosis and obesity. It regulates developmental activities including cell survival, proliferation, differentiation, and function of mononuclear phagocytes. It has been reported that CSF-1 autocrine loop helps to activate macrophages. In actual state, it exists as an autoinhibited form, and upon activation, it dimerizes. Later, it autophosphorylates tyrosine residues in the intracellular domain, followed by the recruitment of signaling molecules as well as internalization of the receptor. Mutation in the CSF1R causes several diseases including myeloid malignancies.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86535

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Xingchao Wang et al.
Frontiers in oncology, 12, 850767-850767 (2022-04-22)
Colony stimulating factor 1 receptor (CSF-1R) is a single channel III transmembrane receptor tyrosine kinase (RTK) and plays an important role in immune regulation and the development of various cancer types. The expression of CSF-1R in colon adenocarcinoma (COAD) and
High co-expression of IL-34 and M-CSF correlates with tumor progression and poor survival in lung cancers
Baghdadi M, et al.
Scientific reports, 8(1), 418-418 (2018)
Harvey I Pass et al.
Oncotarget, 7(35), 56408-56421 (2016-08-04)
In the present work we show that multiple lung cancer cell lines contain cisplatin resistant cell subpopulations expressing the Colony-Stimulating-Factor-Receptor-1 (CSF-1R) and surviving chemotherapy-induced stress. By exploiting siRNA-mediated knock down in vitro and the use of an investigational CSF-1R TKI
Muhammad Baghdadi et al.
Scientific reports, 8(1), 418-418 (2018-01-13)
Despite recent advances in diagnosis and treatment of lung cancers, the 5-year survival rate remains unsatisfactory, which necessitates the identification of novel factors that associates with disease progression and malignant degree for improving diagnostic and therapeutic strategies. Recent progress in
Inhibition of the colony-stimulating-factor-1 receptor affects the resistance of lung cancer cells to cisplatin
Pass H I, et al.
Testing, 7(35), 56408-56408 (2016)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej