Przejdź do zawartości
Merck
Wszystkie zdjęcia(10)

Kluczowe dokumenty

AMAB91130

Sigma-Aldrich

Anti-Choline Acetyltransferase Antibody

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, mouse monoclonal, CL3173

Synonim(y):

Anty-CHOAKTAZA, Anty-CMS1A, Anty-CMS1A2, Anty-CMS6

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych

Wybierz wielkość

100 μL
2440,00 zł

2440,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Rekombinowane, niezawierające konserwantów przeciwciało jest dostępne dla Twojego celu. Wypróbuj ZRB1012


Wybierz wielkość

Zmień widok
100 μL
2440,00 zł

About This Item

Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
NACRES:
NA.43

2440,00 zł


Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Rekombinowane, niezawierające konserwantów przeciwciało jest dostępne dla Twojego celu. Wypróbuj ZRB1012

Nazwa produktu

Monoclonal Anti-CHAT antibody produced in mouse, Prestige Antibodies® Powered by Atlas Antibodies, clone CL3173, purified immunoglobulin, buffered aqueous glycerol solution

pochodzenie biologiczne

mouse

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

CL3173, monoclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Formularz

buffered aqueous glycerol solution

reaktywność gatunkowa

mouse, human, rat

rozszerzona walidacja

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

metody

immunofluorescence: 2-10 μg/mg (Fixation/Permeabilization: PFA/Triton X-100)
immunohistochemistry: 1:1000- 1:2500

izotyp

IgG2b

sekwencja immunogenna

GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... CHAT(1103)

Powiązane kategorie

Opis ogólny

Choline O-acetyltransferase (CHAT) gene is mapped to human chromosome 10q11.23. It has a choline binding domain pocket and a catalytic domain.

Immunogen

choline O-acetyltransferase

Zastosowanie

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Działania biochem./fizjol.

Choline O-acetyltransferase (CHAT) enzyme mediates the synthesis of neurotransmitter, acetylcholine from choline and acetyl-CoA in cholinergic neurons. Phosphorylation at serine and threonine residues is critical for the function of CHAT. Mutations in the active site residues, results in loss of enzyme activity. Deletion in CHAT gene locus impacts neuromuscular signal transmission contributing to muscle weakness in congenital myasthenic syndromes. A mutation in the CHAT gene leads to choline acetyltransferase deficiency and triggers recurrent breathlessness in infants. Polymorphisms in CHAT is implicated in Alzheimer′s disease.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Odpowiadający antygen APREST74314

Postać fizyczna

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Association of Choline Acetyltransferase Gene Polymorphisms (SNPs rs868750G/A, rs1880676G/A, rs2177369G/A and rs3810950G/A) with Alzheimer?s Disease Risk: A Meta-Analysis
Yuan H, et al.
PLoS ONE, 11(7), e0159022-e0159022 (2016)
Functional consequences and structural interpretation of mutations of human choline acetyltransferase
Shen Xm, et al.
Human Mutation, 32(11), 1259-1267 (2011)
Congenital myasthenic syndrome associated with episodic apnea and sudden infant death
Byring RF, et al.
Neuromuscular Disorders, 12(6), 548-553 (2002)
How chromosomal deletions can unmask recessive mutations? Deletions in 10q11. 2 associated with CHAT or SLC18A3 mutations lead to congenital myasthenic syndrome
Schwartz M, et al.
American Journal of Medical Genetics. Part A, 176(1), 151-155 (2018)
Congenital myasthenic syndromes: pathogenesis, diagnosis, and treatment
Engel AG, et al.
Lancet Neurology, 14(4), 420-434 (2015)

Questions

Reviews

No rating value

Active Filters

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej