WH0008518M3

Monoclonal Anti-IKBKAP antibody produced in mouse

clone 6G9, purified immunoglobulin, buffered aqueous solution

• 동의어(들): DKFZp781H1425, DYS, ELP1, FD, IKAP, IKI3, TOT1, inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
• MDL number: MFCD04118553
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 6G9, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: NM_003640
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... IKBKAP(8518)

설명

면역원

IKBKAP (NP_003631, 1242 a.a. ~ 1331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL

생화학적/생리학적 작용

The protein encoded by this gene is a scaffold protein and a regulator for 3 different kinases involved in proinflammatory signaling. This encoded protein can bind NF-kappa-B-inducing kinase (NIK) and IKKs through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia. (provided by RefSeq)

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)