콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

SAB2100143

Sigma-Aldrich

Anti-ARF1 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-ADP-ribosylation factor 1

로그인조직 및 계약 가격 보기

크기 선택

100 μL
₩701,162

₩701,162


예상 입고일2025년 5월 09일세부사항

기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요


크기 선택

보기 변경
100 μL
₩701,162

About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

₩701,162


예상 입고일2025년 5월 09일세부사항

기존과 동일한 품질을 인하된 가격으로 - 어려운 예산 상황을 머크와 함께 극복하세요

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

21 kDa

종 반응성

mouse, human, guinea pig, rat, yeast, sheep, dog, rabbit, horse, bovine

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
immunoprecipitation (IP): suitable
western blot: suitable

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... ARF1(375)

일반 설명

Adenosine diphosphate ribosylation factor 1 (ARF1) protein belongs to the class I ARF family of proteins. This protein is present in the Golgi apparatus. The ARF1 gene is located on the human chromosome at 1q42.13.

면역원

Synthetic peptide directed towards the middle region of human ARF1

애플리케이션

Anti-ARF1 antibody produced in rabbit has been used in western blotting.[1]

생화학적/생리학적 작용

Adenosine diphosphate ribosylation factor 1 (ARF1) plays a role in mediating retrograde and anterograde vesicular traffic. This protein also plays a role in the synthesis of coat protein I (COP-I) coated vesicles. ARF1 is involved in the recruitment of clathrin adaptor complexes such as activator protein 1, 3, and 4. The activation of ARF1 triggers the assembly of spectrin as well as actin cytoskeleton in the Golgi membranes.

서열

Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Yoshimi Ohashi et al.
The Journal of biological chemistry, 287(6), 3885-3897 (2011-12-14)
ADP-ribosylation factor 1 (Arf1) plays a major role in mediating vesicular transport. Brefeldin A (BFA), a known inhibitor of the Arf1-guanine nucleotide exchange factor (GEF) interaction, is highly cytotoxic. Therefore, interaction of Arf1 with ArfGEF is an attractive target for
Transcriptional features of multiple myeloma patients with chromosome 1q gain.
S Fabris et al.
Leukemia, 21(5), 1113-1116 (2007-02-23)
Zhe Sun et al.
Traffic (Copenhagen, Denmark), 8(5), 582-593 (2007-04-25)
The small GTPase ADP-ribosylation factor-1 (Arf1) plays a key role in the formation of coat protein I (COP I)-coated vesicles. Upon recruitment to the donor Golgi membrane by interaction with dimeric p24 proteins, Arf1's GDP is exchanged for GTP. Arf1-GTP
Crislyn D'Souza-Schorey et al.
Nature reviews. Molecular cell biology, 7(5), 347-358 (2006-04-25)
The ADP-ribosylation factor (ARF) small GTPases regulate vesicular traffic and organelle structure by recruiting coat proteins, regulating phospholipid metabolism and modulating the structure of actin at membrane surfaces. Recent advances in our understanding of the signalling pathways that are regulated
Julie G Donaldson et al.
Nature reviews. Molecular cell biology, 12(6), 362-375 (2011-05-19)
Members of the ADP-ribosylation factor (ARF) family of guanine-nucleotide-binding (G) proteins, including the ARF-like (ARL) proteins and SAR1, regulate membrane traffic and organelle structure by recruiting cargo-sorting coat proteins, modulating membrane lipid composition, and interacting with regulators of other G

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.