콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

MSST0039

Sigma-Aldrich

SILuProt IFNG Interferon Gamma human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

동의어(들):

IFNγ, IFN-gamma, IFNG mass-spectrometry standard, Immune interferon, Immuneinterferon, Interferon-gamma mass-spectrometry standard, stable isotope-labeled human IFNG

로그인조직 및 계약 가격 보기

크기 선택

10 μG
₩1,138,729

₩1,138,729


예상 입고일2025년 5월 02일세부사항


벌크 견적 요청

크기 선택

보기 변경
10 μG
₩1,138,729

About This Item

UNSPSC 코드:
23201100
NACRES:
NA.12

₩1,138,729


예상 입고일2025년 5월 02일세부사항


벌크 견적 요청

생물학적 소스

human

Quality Level

재조합

expressed in HEK 293 cells

분석

≥98% (SDS-PAGE)

양식

lyophilized powder

효능

≥98% Heavy amino acids incorporation efficiency by MS

분자량

calculated mol wt 17 kDa

기술

mass spectrometry (MS): suitable

적합성

suitable for mass spectrometry (standard)

UniProt 수납 번호

저장 온도

−20°C

유전자 정보

human ... IFNG(3458)

일반 설명

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.

면역원

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

생화학적/생리학적 작용

SILuProt IFNG is a recombinant, stable isotope-labeled human IFNG which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of IFNG in mass-spectrometry. SILu Prot IFNG is a homodimer consisting of 138 amino acids, with a calculated molecular mass of 17 kDa.

물리적 형태

Supplied as a lyophilized powder containing phosphate buffered saline.

법적 정보

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

11 - Combustible Solids

WGK

WGK 2

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

질문

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.