콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

MSQC2

Sigma-Aldrich

MS QCAL Peptide Mix

lyophilized powder

동의어(들):

MS Qual/Quant QC Mix, universal MS platform standard

로그인조직 및 계약 가격 보기

크기 선택

2 X 25 μG
₩476,035

₩476,035


출고 가능일2025년 4월 07일세부사항


벌크 견적 요청

크기 선택

보기 변경
2 X 25 μG
₩476,035

About This Item

UNSPSC 코드:
12352200
NACRES:
NA.24

₩476,035


출고 가능일2025년 4월 07일세부사항


벌크 견적 요청

양식

lyophilized powder

분석물 화학적 분류

amino acids, peptides, proteins

기술

HPLC: suitable

응용 분야

food and beverages

형식

multi-component solution

배송 상태

ambient

저장 온도

2-8°C

유사한 제품을 찾으십니까? 방문 제품 비교 안내

일반 설명

QCAL was designed using the QconCAT technology and recombinantly expressed in E. coli.  The parent protein sequence of QCAL is as follows:

MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH

QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.

애플리케이션

MSQC2 is intended to act as a universal MS platform standard, by providing several elements for calibration and performance assessment, such as instrument resolution and linearity of signal detection.
This product is optimized to assess platform characteristics, including:
  • Repeatability/Reproducibility between runs
  • System stability (drift, chromatography, signal intensity, sensitivity, etc.)
  • Inter- and intra- platform and lab comparisons

특징 및 장점

General

Complexity
  • Defined mixture gives confidence in your instruments analysis

성분

Each vial contains 25 μg of lyophilized peptides that are derived from trypsin digestion of the protein concatamer QCAL.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Claire E Eyers et al.
Journal of the American Society for Mass Spectrometry, 19(9), 1275-1280 (2008-07-05)
If proteome datasets are to be collated, shared, and merged for higher level proteome analyses, there is a need for generally accepted strategies and reagents for optimization and standardization of instrument performance. At present, there is no single protein or
Julie M Pratt et al.
Nature protocols, 1(2), 1029-1043 (2007-04-05)
An important area of proteomics involves the need for quantification, whether relative or absolute. Many methods now exist for relative quantification, but to support biomarker proteomics and systems biology, absolute quantification rather than relative quantification is required. Absolute quantification usually

질문

  1. 1. I would like to clarify whether this peptide quantity is based on the mass of the E.coli protein before trypsinization. 2. Is this product LC-MS injection-ready? 3. Please provide the protocol for this product.

    1 답변
    1. This product is a mixture of 22 peptides derived from the post-trypsin digest of QCAL. This is a lyophilized powder. Upon reconstitution with an appropriate solvent - typically 0.1% formic or trifluoroacetic acid in water - the solution is injection-ready. Please see the link below to review the product technical bulletin for further instructions for use:
      https://www.sigmaaldrich.com/deepweb/assets/sigmaaldrich/product/documents/827/937/msqc2dat.pdf

      도움이 되었습니까?

후기

평점 값 없음

활성 필터

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.