Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

WH0006334M4

Sigma-Aldrich

Monoclonal Anti-SCN8A antibody produced in mouse

clone 4G7, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-MED, Anti-Nav1.6, Anti-sodium channel, voltage gated, type VIII, alpha

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μG
489,00 €

489,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μG
489,00 €

About This Item

Numero MDL:
Codice UNSPSC:
12352203
NACRES:
NA.41

489,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

4G7, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

rat, mouse, human

tecniche

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SCN8A(6334)

Descrizione generale

Sodium voltage-gated channel αsubunit 8 (SCN8A) is expressed in the central nervous system. The protein is specifically expressed in the axonal initial segment (AIS) and the nodes of Ranvier of myelinated axons. The gene encoding SCN8A is localized on human chromosome 12q13.13.

Immunogeno

SCN8A (NP_055006, 1854 a.a. ~ 1951 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT

Azioni biochim/fisiol

Sodium voltage-gated channel αsubunit 8 (SCN8A) has a role in the generation and conduction of action potential. Mutations in the SCN8A gene have been associated with early infantile epileptic encephalopathy type 13.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

SCN8A mutations in Chinese patients with early onset epileptic encephalopathy and benign infantile seizures.
Wang J
BMC Medical Genetics, 18(1), 104-104 (2017)
Muhammad M Hossain et al.
Experimental neurology, 308, 111-119 (2018-07-19)
Parkinson's disease (PD), the second most common age-related progressive neurodegenerative disorder, is characterized by dopamine depletion and the loss of dopaminergic (DA) neurons with accompanying neuroinflammation. Zonisamide is an-anti-convulsant drug that has recently been shown to improve clinical symptoms of
Sodium channel SCN8A (Nav1.6): properties and de novo mutations in epileptic encephalopathy and intellectual disability.
O'Brien JE and Meisler MH
Frontiers in Genetics (2013)
Xiujie Li et al.
British journal of pharmacology, 178(17), 3553-3569 (2021-04-23)
Microglia-related inflammation is associated with the pathology of Parkinson's disease. Functional voltage-gated sodium channels (VGSCs) are involved in regulating microglial function. Here, we aim to investigate the effects of scorpion venom heat-resistant synthesized peptide (SVHRSP) on 6-hydroxydopamine (6-OHDA)-induced Parkinson's disease-like
AQP4 Aggravates Cognitive Impairment in Sepsis-Associated Encephalopathy through Inhibiting Nav 1.6-Mediated Astrocyte Autophagy.
Zhu, et al.
Advanced science (Weinheim, Baden-Wurttemberg, Germany), 10, e2205862-e2205862 (2023)

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.