Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

WH0003766M1

Sigma-Aldrich

Monoclonal Anti-KCNJ10 antibody produced in mouse

clone 1C11, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-BIRK10, Anti-KCNJ13PEN, Anti-KIR1.2, Anti-KIR4.1, Anti-potassium inwardly-rectifying channel, subfamily J, member 10

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μG
416,00 €

416,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μG
416,00 €

About This Item

Numero MDL:
Codice UNSPSC:
12352203
NACRES:
NA.41

416,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

1C11, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... KCNJ10(3766)

Descrizione generale

Kir4.1/KCNJ10 (potassium voltage-gated channel subfamily J member 10) is an inwardly rectifying potassium (K+) channel. This gene is expressed in the brain, inner ear and kidney. KCNJ10 gene is mapped to human chromosome 1q23.
This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes. (provided by RefSeq)

Immunogeno

KCNJ10 (NP_002232, 276 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

Applicazioni

Monoclonal Anti-KCNJ10 antibody has been used in immunohistochemistry.

Azioni biochim/fisiol

Kir4.1/KCNJ10 (potassium voltage-gated channel subfamily J member 10) helps to regulate the basolateral K+ conductance in the DCT (distal convoluted tubule). It participates in the K+ spatial buffering process, that helps to maintain the resting membrane potential of neurons. Kir4.1 is essential for producing the endocochlear potential of intermediate cells and for retaining high K+ content of the endolymph in ear. In the eye, Kir4.1 plays a vital role in the modulation of the extracellular K+ level and in controlling the healing process of cornea epithelial cells. Mutations in KCNJ10 results in SeSAME (seizures, sensorineural deafness, ataxia, mental retardation and electrolyte imbalance).

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

The expression, regulation, and function of Kir4.1 (Kcnj10) in the mammalian kidney
Su XT and Wang WH
American Journal of Physiology: Renal Physiology, 311(1), F12-F15 (2016)
Seizures, sensorineural deafness, ataxia, mental retardation, and electrolyte imbalance (SeSAME syndrome) caused by mutations in KCNJ10
Scholl UI, et al.
Proceedings of the National Academy of Sciences of the USA, 106(14), 5842-5847 (2009)
Differential loss of KIR4.1 immunoreactivity in multiple sclerosis lesions
Schirmer L, et al.
Annals of Neurology, 75(6), 810-828 (2014)
Unidirectional photoreceptor-to-Muller glia coupling and unique K+ channel expression in Caiman retina
Zayas-Santiago A, et al.
PLoS ONE, 9(5) (2014)
John J Kelly et al.
Journal of cell science, 132(2) (2018-12-19)
Mutations in the genes that encode the gap junction proteins connexin 26 (Cx26, encoded by GJB2) and Cx30 (GJB6) are the leading cause of hereditary hearing loss. That said, the Cx30 p.Ala88Val (A88V) mutant causes Clouston syndrome, but not hearing

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.