WH0003014M5

Monoclonal Anti-H2AFX antibody produced in mouse

clone 3F4, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-H2A histone family, member X, Anti-H2A.X, Anti-H2A/X, Anti-H2AX
• Numero MDL: MFCD07370338
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3F4, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso Genebanck: BC004915
• N° accesso UniProt: P16104
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... H2AFX(3014)

Descrizione

Descrizione generale

H2AFX/H2AX (H2A histone family member X) codes for a key histone, that belongs to the histone H2A gene family. It is located on human chromosome 11q23.3.

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. (provided by RefSeq)

Immunogeno

H2AFX (AAH04915, 1 a.a. ~ 143 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Applicazioni

Monoclonal Anti-H2AFX antibody has been used in western blotting.

Azioni biochim/fisiol

H2AFX (H2A histone family member X) participates in the detection of DNA double-stranded breaks that can lead to translocations. Mutations in H2AFX gene results in non–hodgkin lymphoma.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)