SAB5702268

Anti-Perilipin-2 Antibody, clone 9W7Y9, Rabbit Monoclonal

• Sinonimo/i: PLIN2,ADFP,ADRP
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 9W7Y9, monoclonal
• Forma fisica: liquid
• PM: 52 kDa
• Reattività contro le specie: rat, human, rat
• Concentrazione: 0.91 mg/mL
• tecniche: immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:1000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: DRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH
• N° accesso UniProt: Q99541
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... Perilipin-2(123)

Descrizione

Descrizione generale

The protein encoded by this gene belongs to the perilipin family, members of which coat intracellular lipid storage droplets. This protein is associated with the lipid globule surface membrane material, and maybe involved in development and maintenance of adipose tissue. However, it is not restricted to adipocytes as previously thought, but is found in a wide range of cultured cell lines, including fibroblasts, endothelial and epithelial cells, and tissues, such as lactating mammary gland, adrenal cortex, Sertoli and Leydig cells, and hepatocytes in alcoholic liver cirrhosis, suggesting that it may serve as a marker of lipid accumulation in diverse cell types and diseases. Alternatively spliced transcript variants have been found for this gene.

Immunogeno

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 88-437 of human Perilipin-2 (NP_001113.2).

Applicazioni

WB, IHC, IF/ICC

Informazioni sulla sicurezza

• Pittogrammi: GHS07,GHS09
• Avvertenze: Warning
• Indicazioni di pericolo: H317,H411
• Consigli di prudenza: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classi di pericolo: Aquatic Chronic 2 - Skin Sens. 1
• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3