Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

SAB2108453

Sigma-Aldrich

Anti-TFEB

affinity isolated antibody

Sinonimo/i:

Anti-Math5

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
520,00 €

520,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
520,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

520,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

53 kDa

Reattività contro le specie

horse, human, rabbit, pig, mouse, goat, bovine, rat

Concentrazione

0.5-1 mg/mL

tecniche

immunoblotting: suitable

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TFEB(7942)

Descrizione generale

Transcription factor EB (TFEB) is encoded by the gene mapped to human chromosome 6p21.1. The encoded protein belongs to the MiT transcription factor family. TFEB is widely expressed and is characterized with a transactivation domain, basic-helix-loop-helix domain, glutamine rich region, leucine zipper region and proline rich region.

Immunogeno

Synthetic peptide directed towards the middle region of human TFEB

Azioni biochim/fisiol

Transcription factor EB (TFEB) plays a key role in the regulation of autophagy and lysosome biogenesis. TFEB, expressed in endothelial cells, reduces inflammation and hinders atherosclerosis development. Thus, this protein can be considered as a potent therapeutic target for atherosclerosis and associated cardiovascular diseases.

Sequenza

Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

The Transcription Factor EB Links Cellular Stress to the Immune Response
Nabar NR, et al.
The Yale Journal of Biology and Medicine, 90(2), 301-315 (2017)
Molecular Genetics and Cellular Characteristics of TFE3 and TFEB Translocation Renal Cell Carcinomas
Kauffman EC, et al.
Nature reviews. Urology, 11(8), 465-465 (2014)
TFEB inhibits endothelial cell inflammation and reduces atherosclerosis.
Lu H, et al.
Science Signaling, 10(464) (2017)

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.