SAB2101084

Anti-HSD11B1 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-11-β-HSD1, Anti-11-DH, Anti-HDL, Anti-HSD11, Anti-Hydroxysteroid (11-β) dehydrogenase 1
• Numero MDL: MFCD08064405
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 32 kDa
• Reattività contro le specie: human, mouse, rat, guinea pig
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso UniProt: P28845
• applicazioni: research pathology
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... HSD11B1(3290)

Descrizione

Descrizione generale

Hydroxysteroid 11-beta dehydrogenase 1 (HSD11B1) short-chain dehydrogenase/reductase superfamily and anchors on the endoplasmic reticulum (ER) membrane. It comprises a hydrophobic N terminus and a catalytic domain. The HSD11B1 gene is mapped to human chromosome location 1q32.2.

Immunogeno

Synthetic peptide directed towards the N terminal region of human HSD11B1

Azioni biochim/fisiol

Mutation in the hydroxysteroid 11-β dehydrogenase 1 (HSD11B1) gene is implicated in cortisone reductase deficiency.

Sequenza

Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable